Mouse anti-Human EIF5A Monoclonal Antibody | anti-EIF5A antibody

EIF5A (Eukaryotic Translation Initiation Factor 5A-1, eIF-5A-1, eIF-5A1, Eukaryotic Initiation Factor 5A Isoform 1, eIF-5A, eIF-4D, Rev-binding Factor) (FITC)

Cat. Num. AAA6147006

• Gene Names: EIF5A; EIF-5A; EIF5A1; eIF5AI
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EIF5A; Monoclonal Antibody; EIF5A (Eukaryotic Translation Initiation Factor 5A-1; eIF-5A-1; eIF-5A1; Eukaryotic Initiation Factor 5A Isoform 1; eIF-5A; eIF-4D; Rev-binding Factor) (FITC); anti-EIF5A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8C1
• Specificity: Recognizes human EIF5A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-EIF5A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-154 from human EIF5A (NP_001961.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (43.2kD).)

Western Blot (WB)

(Western Blot analysis of EIF5A expression in transfected 293T cell line by EIF5A monoclonal antibody. Lane 1: EIF5A transfected lysate (16.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged EIF5A is 3ng/ml as a capture antibody.)

Related Product Information for anti-EIF5A antibody

EIF5A precursor is the only cellular protein known to contain a specific lysine residue which is transformed into the unique amino acid hypusine [N-(4-amino-2-hydroxybutyl)-lysine] by a series of post translational reactions. eIF5A promotes the formation of the first peptide bond during the initial stage of protein synthesis.

Product Categories/Family for anti-EIF5A antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4503545
• NCBI GeneID: 1984
• NCBI Accession #: NP_001961.1
• NCBI GenBank Nucleotide #: NM_001970.3
• UniProt Accession #: P63241; P10159; Q16182; Q7L7L3; Q7Z4L1; Q9D0G2; A8K9A0; D3DTP2; AAB29229
• Molecular Weight: 20,170 Da
• NCBI Official Full Name: eukaryotic translation initiation factor 5A-1 isoform B
• NCBI Official Synonym Full Names: eukaryotic translation initiation factor 5A
• NCBI Official Symbol: EIF5A
• NCBI Official Synonym Symbols: EIF-5A; EIF5A1; eIF5AI
• NCBI Protein Information: eukaryotic translation initiation factor 5A-1; eIF-4D; eIF-5A1; eIF-5A-1; rev-binding factor; eukaryotic initiation factor 5A
• UniProt Protein Name: Eukaryotic translation initiation factor 5A-1
• Protein Family: Translation initiation factor
• UniProt Gene Name: EIF5A
• UniProt Synonym Gene Names: eIF-5A-1; eIF-5A1; eIF-5A
• UniProt Entry Name: IF5A1_HUMAN

Uniprot Description

EIF5A: mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF- alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts. Belongs to the eIF-5A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Translation initiation; Translation

Chromosomal Location of Human Ortholog: 17p13-p12

Cellular Component: endoplasmic reticulum membrane; membrane; cytoplasm; nuclear pore; cytosol; nucleus; annulate lamellae

Molecular Function: protein binding; RNA binding; ribosome binding; protein N-terminus binding; translation elongation factor activity; U6 snRNA binding

Biological Process: mRNA export from nucleus; translational frameshifting; cellular protein metabolic process; apoptosis; positive regulation of cell proliferation; nucleocytoplasmic transport; positive regulation of translational elongation; hypusine biosynthetic process from peptidyl-lysine; protein export from nucleus; post-translational protein modification; positive regulation of translational termination