Mouse anti-Human EIF4G3 Monoclonal Antibody | anti-EIF4G3 antibody

EIF4G3 (Eukaryotic Translation Initiation Factor 4 gamma 3, eIF-4-gamma 3, eIF-4G 3, eIF4G 3, eIF-4-gamma II, eIF4GII) (FITC)

Cat. Num. AAA6147003

• Gene Names: EIF4G3; eIF4G 3; eIF4GII; eIF-4G 3
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EIF4G3; Monoclonal Antibody; EIF4G3 (Eukaryotic Translation Initiation Factor 4 gamma 3; eIF-4-gamma 3; eIF-4G 3; eIF4G 3; eIF-4-gamma II; eIF4GII) (FITC); anti-EIF4G3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1H5
• Specificity: Recognizes human EIF4G3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-EIF4G3 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-516 from EIF4G3 (AAH30578) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNSQPQTRSPFAAGPRPPHHQFFQRPQIQPPRATIPNSSPSIRPGAQTPTAVYQANQHIMMVNHLPMPYPVPQGPQYCIPQYRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDFPNAYGTPFYPSQPVYQSAPIMVPTQQQPPPAKREKKTIRIRDPNQGGKDITEEIISGGGSRNPTPPIGRPTSTPTPPQQLPSQVPEHSPVVYGTVESAHLAASTPVTAASDQKQEEKPKPDPVLKSPSPVLRLVLSGEKK
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western blot analysis of EIF4G3 over-expressed 293 cell line, cotransfected with EIF4G3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with EIF4G3 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Detection limit for recombinant GST tagged EIF4G3 is ~1ng/ml as a capture antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EIF4G3 on formalin-fixed paraffin-embedded human lung, adenosqumous cell carcinoma. [antibody concentration 3ug/ml].)

Western Blot (WB)

(Western Blot analysis of EIF4G3 expression in transfected 293T cell line by EIF4G3 monoclonal antibody Lane 1: EIF4G3 transfected lysate (55.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(EIF4G3 monoclonal antibody Western Blot analysis of EIF4G3 expression in MCF-7.)

Product Categories/Family for anti-EIF4G3 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 22539617
• NCBI GeneID: 8672
• Molecular Weight: 146,871 Da
• NCBI Official Full Name: Homo sapiens eukaryotic translation initiation factor 4 gamma, 3, mRNA
• NCBI Official Synonym Full Names: eukaryotic translation initiation factor 4 gamma 3
• NCBI Official Symbol: EIF4G3
• NCBI Official Synonym Symbols: eIF4G 3; eIF4GII; eIF-4G 3
• NCBI Protein Information: eukaryotic translation initiation factor 4 gamma 3
• Protein Family: Eukaryotic translation initiation factor

NCBI Description

The protein encoded by this gene is thought to be part of the eIF4F protein complex, which is involved in mRNA cap recognition and transport of mRNAs to the ribosome. Interestingly, a microRNA (miR-520c-3p) has been found that negatively regulates synthesis of the encoded protein, and this leads to a global decrease in protein translation and cell proliferation. Therefore, this protein is a key component of the anti-tumor activity of miR-520c-3p. [provided by RefSeq, May 2016]