Western Blot (WB)
(Western Blot detection against Immunogen (34.65kD))
Mouse anti-Human EIF1AY Monoclonal Antibody | anti-EIF1AY antibody
EIF1AY (Eukaryotic Translation Initiation Factor 1A, Y-chromosomal, Eukaryotic Translation Initiation Factor 4C) (AP)
Gene Names
EIF1AY; eIF-4C
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EIF1AY; Monoclonal Antibody; EIF1AY (Eukaryotic Translation Initiation Factor 1A; Y-chromosomal; Eukaryotic Translation Initiation Factor 4C) (AP); anti-EIF1AY antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B4
Specificity
Recognizes human EIF1AY.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-EIF1AY antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa22-96 from EIF1AY (AAH05248) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKY
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (34.65kD))
Western Blot (WB)
(Western Blot detection against Immunogen (34.65kD))
Western Blot (WB)
(EIF1AY monoclonal antibody Western Blot analysis of EIF1AY expression in HeLa.)
Western Blot (WB)
(EIF1AY monoclonal antibody Western Blot analysis of EIF1AY expression in HeLa.)
Western Blot (WB)
(Western Blot analysis of EIF1AY expression in transfected 293T cell line by EIF1AY monoclonal antibody)
Western Blot (WB)
(Western Blot analysis of EIF1AY expression in transfected 293T cell line by EIF1AY monoclonal antibody)
Related Product Information for anti-EIF1AY antibody
This gene encodes a protein similar to eukaryotic translation initiation factor 1A (EIF1A). EIF1A is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA.
Product Categories/Family for anti-EIF1AY antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
16,442 Da
NCBI Official Full Name
Homo sapiens eukaryotic translation initiation factor 1A, Y-linked, mRNA
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 1A, Y-linked
NCBI Official Symbol
EIF1AY
NCBI Official Synonym Symbols
eIF-4C
NCBI Protein Information
eukaryotic translation initiation factor 1A, Y-chromosomal
Protein Family
NCBI Description
This gene is located on the non-recombining region of the Y chromosome. It encodes a protein related to eukaryotic translation initiation factor 1A (EIF1A), which may function in stabilizing the binding of the initiator Met-tRNA to 40S ribosomal subunits. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Research Articles on EIF1AY
Similar Products
Product Notes
The EIF1AY (Catalog #AAA6131076) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EIF1AY (Eukaryotic Translation Initiation Factor 1A, Y-chromosomal, Eukaryotic Translation Initiation Factor 4C) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EIF1AY can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EIF1AY for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EIF1AY, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
