Mouse anti-Human EFNA3 Monoclonal Antibody | anti-EFNA3 antibody

EFNA3 (Ephrin-A3, EFL-2, EHK1 Ligand, EHK1-L, EPH-related Receptor Tyrosine Kinase Ligand 3, LERK-3, EFL2, EPLG3, LERK3) (PE)

Cat. Num. AAA6157580

• Gene Names: EFNA3; EFL2; EPLG3; LERK3; Ehk1-L
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EFNA3; Monoclonal Antibody; EFNA3 (Ephrin-A3; EFL-2; EHK1 Ligand; EHK1-L; EPH-related Receptor Tyrosine Kinase Ligand 3; LERK-3; EFL2; EPLG3; LERK3) (PE); anti-EFNA3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C12
• Specificity: Recognizes human EFNA3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1769

• Applicable Applications for anti-EFNA3 antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-238 from human EFNA3 (AAH17722) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of EFNA3 transfected lysate using EFNA3 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with EFNA3 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged EFNA3 is 3ng/ml as a capture antibody.)

Related Product Information for anti-EFNA3 antibody

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling.

Product Categories/Family for anti-EFNA3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 17389356
• NCBI GeneID: 1944
• NCBI Official Full Name: Homo sapiens ephrin-A3, mRNA
• NCBI Official Synonym Full Names: ephrin A3
• NCBI Official Symbol: EFNA3
• NCBI Official Synonym Symbols: EFL2; EPLG3; LERK3; Ehk1-L
• NCBI Protein Information: ephrin-A3
• Protein Family: Ephrin

NCBI Description

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. [provided by RefSeq, Jul 2008]