Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DYRK1B Monoclonal Antibody | anti-DYRK1B antibody

DYRK1B (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1B, Minibrain-related Kinase, Mirk Protein Kinase, MIRK) (MaxLight 490)

Gene Names
DYRK1B; MIRK; AOMS3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DYRK1B; Monoclonal Antibody; DYRK1B (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1B; Minibrain-related Kinase; Mirk Protein Kinase; MIRK) (MaxLight 490); anti-DYRK1B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E8
Specificity
Recognizes human DYRK1B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
2487
Applicable Applications for anti-DYRK1B antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa479-569 from DYRK1B (AAH25291) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLV
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DYRK1B antibody
DYRK1B is a member of the DYRK/minibrain family of dual specificity tyrosine-regulated, arginine-directed protein kinases. It is a serine/threonine protein kinase which is expressed at elevated levels in normal skeletal muscle and certain carcinoma cell lines. It contains all motifs characteristic for the DYRK family of protein kinases. In addition, the protein also comprises a bipartite nuclear localization motif. The protein functions as a transactivator of a different transcription factor, HNF1a, to which it binds through the dimerization co-factor DcoH of HNF1a. Human DYRK1B gene is mapped to chromosome 19 (19q12-13.11).
Product Categories/Family for anti-DYRK1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B, mRNA
NCBI Official Synonym Full Names
dual specificity tyrosine phosphorylation regulated kinase 1B
NCBI Official Symbol
DYRK1B
NCBI Official Synonym Symbols
MIRK; AOMS3
NCBI Protein Information
dual specificity tyrosine-phosphorylation-regulated kinase 1B

NCBI Description

This gene encodes a member of a family of nuclear-localized protein kinases. The encoded protein participates in the regulation of the cell cycle. Expression of this gene may be altered in tumor cells, and mutations in this gene were found to cause abdominal obesity-metabolic syndrome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]

Research Articles on DYRK1B

Similar Products

Product Notes

The DYRK1B (Catalog #AAA6200569) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DYRK1B (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1B, Minibrain-related Kinase, Mirk Protein Kinase, MIRK) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DYRK1B can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DYRK1B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DYRK1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.