Mouse anti-Human DUT Monoclonal Antibody | anti-DUT antibody

DUT (Deoxyuridine 5'-triphosphate Nucleotidohydrolase, Mitochondrial, dUTPase, dUTP Pyrophosphatase) (Biotin)

Cat. Num. AAA6141630

• Gene Names: DUT; dUTPase
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DUT; Monoclonal Antibody; DUT (Deoxyuridine 5'-triphosphate Nucleotidohydrolase; Mitochondrial; dUTPase; dUTP Pyrophosphatase) (Biotin); anti-DUT antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C9
• Specificity: Recognizes human DUT.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-DUT antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa68-164 from human DUT (AAH33645) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB)

(Western Blot analysis of DUT expression in transfected 293T cell line by DUT monoclonal antibody. Lane 1: DUT transfected lysate (18kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DUT on formalin-fixed paraffin-embedded human colon. [antibody concentration 1ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DUT on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DUT is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-DUT antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 21708113
• NCBI GeneID: 1854
• Molecular Weight: 17,748 Da
• NCBI Official Full Name: Homo sapiens deoxyuridine triphosphatase, mRNA
• NCBI Official Synonym Full Names: deoxyuridine triphosphatase
• NCBI Official Symbol: DUT
• NCBI Official Synonym Symbols: dUTPase
• NCBI Protein Information: deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
• Protein Family: Deoxyuridine 5'-triphosphate nucleotidohydrolase

NCBI Description

This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. [provided by RefSeq, Jul 2008]