Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human DTNBP1 Monoclonal Antibody | anti-DTNBP1 antibody

DTNBP1 (Dysbindin, Biogenesis of Lysosome-related Organelles Complex 1 Subunit 8, BLOC-1 Subunit 8, Dysbindin-1, Dystrobrevin-binding Protein 1, Hermansky-Pudlak Syndrome 7 Protein, HPS7 Protein, BLOC1S8, My031)

Gene Names
DTNBP1; SDY; DBND; HPS7; My031; BLOC1S8
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DTNBP1; Monoclonal Antibody; DTNBP1 (Dysbindin; Biogenesis of Lysosome-related Organelles Complex 1 Subunit 8; BLOC-1 Subunit 8; Dysbindin-1; Dystrobrevin-binding Protein 1; Hermansky-Pudlak Syndrome 7 Protein; HPS7 Protein; BLOC1S8; My031); Anti -DTNBP1 (Dysbindin; anti-DTNBP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B4
Specificity
Recognizes human DTNBP1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELVDSEVVMLSAHWEKKKTSLVELQEQ
Applicable Applications for anti-DTNBP1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1-101 from human DTNBP1 (AAH11912) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)
Related Product Information for anti-DTNBP1 antibody
Dtnbp1 may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations are associated with Hermansky-Pudlak syndrome type 7. This protein may also be associated with schizophrenia.
Product Categories/Family for anti-DTNBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,493 Da
NCBI Official Full Name
dysbindin isoform e
NCBI Official Synonym Full Names
dystrobrevin binding protein 1
NCBI Official Symbol
DTNBP1
NCBI Official Synonym Symbols
SDY; DBND; HPS7; My031; BLOC1S8
NCBI Protein Information
dysbindin; dysbindin-1; BLOC-1 subunit 8; Hermansky-Pudlak syndrome 7 protein; biogenesis of lysosomal organelles complex-1, subunit 8; biogenesis of lysosome-related organelles complex 1 subunit 8
UniProt Protein Name
Dysbindin
Protein Family
UniProt Gene Name
DTNBP1
UniProt Synonym Gene Names
BLOC1S8; BLOC-1 subunit 8
UniProt Entry Name
DTBP1_HUMAN

NCBI Description

This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations in this gene are associated with Hermansky-Pudlak syndrome type 7. This gene may also be associated with schizophrenia. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DTNBP1: The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. Plays a role in intracellular vesicle trafficking. Plays a role in synaptic vesicle trafficking and in neurotransmitter release. May be required for normal dopamine homeostasis in the cerebral cortex, hippocampus, and hypothalamus. Plays a role in the regulation of cell surface exposure of DRD2. Contributes to the regulation of dopamine signaling. May play a role in actin cytoskeleton reorganization and neurite outgrowth. May modulate MAPK8 phosphorylation. Part of the biogenesis of lysosome-related organelles complex 1 (BLOC-1). The BLOC-1 complex is composed of BLOC1S1, BLOC1S2, BLOC1S3, DTNBP1, MUTED, PLDN, CNO/cappuccino and SNAPIN. Binds to DTNA and DTNB but may not be a physiological binding partner (PubMed:16980328). Interacts with RNF151 and CMYA5. Identified in a complex with the adapter-related protein complex 3 (AP-3). Interacts with TRIM32, AP3M1 and AP3B2. Identified in a complex with the biogenesis of lysosome-related organelles complex 2 (BLOC-2). Interacts with the DNA-dependent protein kinase complex DNA-PK. Detected in brain, in neurons and in neuropil. Detected in dentate gyrus and in pyramidal cells of hippocampus CA2 and CA3. Belongs to the dysbindin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: endoplasmic reticulum membrane; neuron projection; synaptic vesicle membrane; postsynaptic density; melanosome membrane; dendritic spine; cytosol; postsynaptic membrane; growth cone; axon; cytoplasm; endosome membrane; cell junction; sarcoplasm; nucleus; sarcolemma

Molecular Function: protein binding

Biological Process: platelet dense granule organization and biogenesis; melanosome organization and biogenesis; regulation of dopamine receptor signaling pathway; anterograde synaptic vesicle transport; actin cytoskeleton reorganization; post-Golgi vesicle-mediated transport; anterograde axon cargo transport; blood coagulation; positive regulation of neurotransmitter secretion; regulation of dopamine secretion; neurite morphogenesis; neurite development

Disease: Schizophrenia; Hermansky-pudlak Syndrome 7

Research Articles on DTNBP1

Similar Products

Product Notes

The DTNBP1 dtnbp1 (Catalog #AAA6011562) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DTNBP1 (Dysbindin, Biogenesis of Lysosome-related Organelles Complex 1 Subunit 8, BLOC-1 Subunit 8, Dysbindin-1, Dystrobrevin-binding Protein 1, Hermansky-Pudlak Syndrome 7 Protein, HPS7 Protein, BLOC1S8, My031) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DTNBP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the DTNBP1 dtnbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLETLRERLL SVQQDFTSGL KTLSDKSREA KVKSKPRTVP FLPKYSAGLE LLSRYEDTWA ALHRRAKDCA SAGELVDSEV VMLSAHWEKK KTSLVELQEQ. It is sometimes possible for the material contained within the vial of "DTNBP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.