Mouse anti-Human DSC2 Monoclonal Antibody | anti-DSC2 antibody

DSC2 (Desmocollin-2, Cadherin Family Member 2, Desmocollin-3, Desmosomal Glycoprotein II, Desmosomal Glycoprotein III, CDHF2, DSC3) (FITC)

Cat. Num. AAA6146915

• Gene Names: DSC3; DSC; DSC1; DSC2; DSC4; CDHF3; HT-CP
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DSC2; Monoclonal Antibody; DSC2 (Desmocollin-2; Cadherin Family Member 2; Desmocollin-3; Desmosomal Glycoprotein II; Desmosomal Glycoprotein III; CDHF2; DSC3) (FITC); anti-DSC2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4D2
• Specificity: Recognizes human DSC3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-DSC2 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa585-684 from human DSC3 (NP_001932) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: CKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVNDTAARLSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRST
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DSC3 on A-431 cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DSC3 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-DSC2 antibody

Antibodies; Cadherin

NCBI and Uniprot Product Information

• NCBI GI #: 148539846
• NCBI GeneID: 1825
• NCBI Accession #: NP_001932
• NCBI GenBank Nucleotide #: NM_001941
• UniProt Accession #: Q14574
• Molecular Weight: 85kDa
• NCBI Official Full Name: desmocollin-3 isoform Dsc3a preproprotein
• NCBI Official Synonym Full Names: desmocollin 3
• NCBI Official Symbol: DSC3
• NCBI Official Synonym Symbols: DSC; DSC1; DSC2; DSC4; CDHF3; HT-CP
• NCBI Protein Information: desmocollin-3
• UniProt Protein Name: Desmocollin-3
• Protein Family: Desmocollin
• UniProt Gene Name: DSC3
• UniProt Synonym Gene Names: CDHF3; DSC4
• UniProt Entry Name: DSC3_HUMAN

NCBI Description

The protein encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation. The desmosomal family members are arranged in two clusters on chromosome 18, occupying less than 650 kb combined. Mutations in this gene are a cause of hypotrichosis and recurrent skin vesicles disorder. The protein can act as an autoantigen in pemphigus diseases, and it is also considered to be a biomarker for some cancers. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2014]