Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DPF2 monoclonal antibody, Western Blot analysis of DPF2 expression in LNCaP.)

Mouse anti-Human DPF2 Monoclonal Antibody | anti-DPF2 antibody

DPF2 (REQ, UBID4, ubi-d4, MGC10180, Zinc Finger Protein ubi-d4, Protein Requiem, Apoptosis Response Zinc Finger Protein, D4, Zinc And Double PHD Fingers Family 2, BRG1-associated Factor 45D, BAF45D) (FITC)

Gene Names
DPF2; REQ; UBID4; ubi-d4
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DPF2; Monoclonal Antibody; DPF2 (REQ; UBID4; ubi-d4; MGC10180; Zinc Finger Protein ubi-d4; Protein Requiem; Apoptosis Response Zinc Finger Protein; D4; Zinc And Double PHD Fingers Family 2; BRG1-associated Factor 45D; BAF45D) (FITC); anti-DPF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F6
Specificity
Recognizes human DPF2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-DPF2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa56-155 from human DPF2 (AAH14889) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DPF2 monoclonal antibody, Western Blot analysis of DPF2 expression in LNCaP.)

Western Blot (WB) (DPF2 monoclonal antibody, Western Blot analysis of DPF2 expression in LNCaP.)

Western Blot (WB)

(Western Blot analysis of DPF2 expression in transfected 293T cell line by DPF2 monoclonal antibody. Lane 1: DPF2 transfected lysate (44kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DPF2 expression in transfected 293T cell line by DPF2 monoclonal antibody. Lane 1: DPF2 transfected lysate (44kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DPF2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 6ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to DPF2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 6ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DPF2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DPF2 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-DPF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
23,599 Da
NCBI Official Full Name
Homo sapiens D4, zinc and double PHD fingers family 2, mRNA
NCBI Official Synonym Full Names
double PHD fingers 2
NCBI Official Symbol
DPF2
NCBI Official Synonym Symbols
REQ; UBID4; ubi-d4
NCBI Protein Information
zinc finger protein ubi-d4
Protein Family

NCBI Description

The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors. [provided by RefSeq, Jul 2008]

Research Articles on DPF2

Similar Products

Product Notes

The DPF2 (Catalog #AAA6146900) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DPF2 (REQ, UBID4, ubi-d4, MGC10180, Zinc Finger Protein ubi-d4, Protein Requiem, Apoptosis Response Zinc Finger Protein, D4, Zinc And Double PHD Fingers Family 2, BRG1-associated Factor 45D, BAF45D) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DPF2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DPF2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DPF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.