Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (78.36kD).)

Mouse anti-Human DNPEP Monoclonal Antibody | anti-DNPEP antibody

DNPEP (ASPEP, DAP, Aspartyl Aminopeptidase) (FITC)

Gene Names
DNPEP; DAP; ASPEP
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DNPEP; Monoclonal Antibody; DNPEP (ASPEP; DAP; Aspartyl Aminopeptidase) (FITC); anti-DNPEP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F9-3A7
Specificity
Recognizes human DNPEP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-DNPEP antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-476 from DNPEP (AAH00653) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MQVAMNGKARKEAVQTAAKELLKFVNRSPSPFHAVAECRNRLLQAGFSELKETEKWNIKPESKYFMTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVKCPTSGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEPGPLNAVDERHHSVLMSLLCAHLGLSPKDIVEMELCLADTQPAVLGGAYD
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (78.36kD).)

Western Blot (WB) (Western Blot detection against Immunogen (78.36kD).)

Western Blot (WB)

(DNPEP monoclonal antibody Western Blot analysis of DNPEP expression in MCF-7.)

Western Blot (WB) (DNPEP monoclonal antibody Western Blot analysis of DNPEP expression in MCF-7.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DNPEP on MCF-7 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DNPEP on MCF-7 cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-DNPEP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
52,428 Da
NCBI Official Full Name
Homo sapiens aspartyl aminopeptidase, mRNA
NCBI Official Synonym Full Names
aspartyl aminopeptidase
NCBI Official Symbol
DNPEP
NCBI Official Synonym Symbols
DAP; ASPEP
NCBI Protein Information
aspartyl aminopeptidase

NCBI Description

The protein encoded by this gene is an aminopeptidase which prefers acidic amino acids, and specifically favors aspartic acid over glutamic acid. It is thought to be a cytosolic protein involved in general metabolism of intracellular proteins. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]

Research Articles on DNPEP

Similar Products

Product Notes

The DNPEP (Catalog #AAA6146892) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DNPEP (ASPEP, DAP, Aspartyl Aminopeptidase) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNPEP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DNPEP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DNPEP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.