Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse DNAJC10 Monoclonal Antibody | anti-DNAJC10 antibody

DNAJC10 (DnaJ Homolog Subfamily C Member 10, ER-resident Protein ERdj5, Macrothioredoxin, MTHr, ERDJ5, UNQ495/PRO1012, DKFZp434J1813, MGC104194) (MaxLight 490)

Gene Names
DNAJC10; JPDI; MTHr; ERdj5; PDIA19
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DNAJC10; Monoclonal Antibody; DNAJC10 (DnaJ Homolog Subfamily C Member 10; ER-resident Protein ERdj5; Macrothioredoxin; MTHr; ERDJ5; UNQ495/PRO1012; DKFZp434J1813; MGC104194) (MaxLight 490); anti-DNAJC10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C4
Specificity
Recognizes human DNAJC10. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-DNAJC10 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa688-794 from human DNAJC10 (NP_061854) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-DNAJC10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
dnaJ homolog subfamily C member 10 isoform 2
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member C10
NCBI Official Symbol
DNAJC10
NCBI Official Synonym Symbols
JPDI; MTHr; ERdj5; PDIA19
NCBI Protein Information
dnaJ homolog subfamily C member 10
UniProt Protein Name
DnaJ homolog subfamily C member 10
Protein Family
UniProt Gene Name
DNAJC10
UniProt Synonym Gene Names
ERDJ5; ER-resident protein ERdj5; ERdj5; MTHr
UniProt Entry Name
DJC10_HUMAN

NCBI Description

This gene encodes an endoplasmic reticulum co-chaperone which is part of the endoplasmic reticulum-associated degradation complex involved in recognizing and degrading misfolded proteins. The encoded protein reduces incorrect disulfide bonds in misfolded glycoproteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2012]

Uniprot Description

DNAJC10: This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. May act as a co-chaperone for HSPA5. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Chaperone; Secreted, signal peptide; Secreted; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 2q32.1

Cellular Component: membrane; endoplasmic reticulum; endoplasmic reticulum lumen

Molecular Function: disulfide oxidoreductase activity; protein binding; ATPase activator activity; chaperone binding; protein disulfide oxidoreductase activity; Hsp70 protein binding; misfolded protein binding; oxidoreductase activity, acting on sulfur group of donors, disulfide as acceptor; ATPase binding

Biological Process: ER-associated protein catabolic process; negative regulation of protein amino acid phosphorylation; positive regulation of ATPase activity; cell redox homeostasis

Research Articles on DNAJC10

Similar Products

Product Notes

The DNAJC10 dnajc10 (Catalog #AAA6200513) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DNAJC10 (DnaJ Homolog Subfamily C Member 10, ER-resident Protein ERdj5, Macrothioredoxin, MTHr, ERDJ5, UNQ495/PRO1012, DKFZp434J1813, MGC104194) (MaxLight 490) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DNAJC10 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DNAJC10 dnajc10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DNAJC10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.