Testing Data
(Detection limit for recombinant GST tagged DMP1 is 1 ng/ml using MBS631874 as a capture antibody.)
Mouse anti-Human DMP1 Monoclonal Antibody
DMP1 (Dentin Matrix Acidic Phosphoprotein 1, DMP-1, Dentin Matrix Protein 1)
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Purified
Synonyms
DMP1; Monoclonal Antibody; DMP1 (Dentin Matrix Acidic Phosphoprotein 1; DMP-1; Dentin Matrix Protein 1); Anti -DMP1 (Dentin Matrix Acidic Phosphoprotein 1; anti-DMP1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b, k
Clone Number
1D4
Specificity
Recognizes human DMP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Concentration
0.46mg/ml (varies by lot)
Sequence
ESIRSERGNSRMNSAGMKSKESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRSELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEES
Applicable Applications for anti-DMP1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Immunofluorescence: 10ug/ml HeLa cells.
Other applications not tested.
Optimal dilutions to be determined by the researcher.
Other applications not tested.
Optimal dilutions to be determined by the researcher.
Immunogen
DMP1 (NP_004398, 221-331aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged DMP1 is 1 ng/ml using MBS631874 as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged DMP1 is 1 ng/ml using MBS631874 as a capture antibody.)
Western Blot (WB)
(Western Blot detection against Immunogen using MBS631874 (38.21kD).)
Western Blot (WB)
(Western Blot detection against Immunogen using MBS631874 (38.21kD).)
Immunofluorescence (IF)
(Immunofluorescence of HeLa cell using MBS631874 (10 ug/ml).)
Immunofluorescence (IF)
(Immunofluorescence of HeLa cell using MBS631874 (10 ug/ml).)
Related Product Information for anti-DMP1 antibody
DMP1 is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. It is critical for proper mineralization of bone and dentin, and is present in diverse cells of bone and tooth tissues. DMP1 contains a large number of acidic domains, multiple phosphorylation sites, a functional arg-gly-asp cell attachment sequence, and a DNA binding domain. DMP1 may also have a dual function during osteoblast differentiation. In the nucleus of undifferentiated osteoblasts the unphosphorylated form acts as a transcriptional component for activation of osteoblast-specific genes like osteocalcin. During the osteoblast to osteocyte transition phase it is phosphorylated and exported into the extracellular matrix, where it regulates nucleation of hydroxyapatite.
Product Categories/Family for anti-DMP1 antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The DMP1 (Catalog #AAA631874) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DMP1 (Dentin Matrix Acidic Phosphoprotein 1, DMP-1, Dentin Matrix Protein 1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DMP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Immunofluorescence: 10ug/ml HeLa cells. Other applications not tested. Optimal dilutions to be determined by the researcher. Researchers should empirically determine the suitability of the DMP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ESIRSERGNS RMNSAGMKSK ESGENSEQAN TQDSGGSQLL EHPSRKIFRK SRISEEDDRS ELDDNNTMEE VKSDSTENSN SRDTGLSQPR RDSKGDSQED SKENLSQEES. It is sometimes possible for the material contained within the vial of "DMP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
