Western Blot (WB)
(Western Blot detection against Immunogen (35.64kD).)
Mouse anti-Human DLX6 Monoclonal Antibody | anti-DLX6 antibody
DLX6 (Homeobox Protein DLX-6) (AP)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DLX6; Monoclonal Antibody; DLX6 (Homeobox Protein DLX-6) (AP); anti-DLX6 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D7
Specificity
Recognizes human DLX6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DLX6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa71-160 from human DLX6 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (35.64kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (35.64kD).)
Western Blot (WB)
(Western Blot analysis of DLX6 expression in transfected 293T cell line by DLX6 monoclonal antibody. Lane 1: DLX6 transfected lysate (19.708kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of DLX6 expression in transfected 293T cell line by DLX6 monoclonal antibody. Lane 1: DLX6 transfected lysate (19.708kD). Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged DLX6 is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged DLX6 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-DLX6 antibody
First expressed in embryos at 8.5-9 days in facial and branchial arch mesenchyme, otic vesicles and frontonasal ectoderm around olfactory placodes, a day later expression is seen in the developing forebrain in primordia of the ganglionic eminence and ventral diencephalic regions. In day 12.5 embryos, expressed in the brain and bones, and also in all skeletal structures of midgestation embryos after the first cartilage formation, and expression progressively declines in both brain and skeleton in day 15 embryos.
Product Categories/Family for anti-DLX6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Synonym Full Names
distal-less homeobox 6
NCBI Official Symbol
DLX6
NCBI Protein Information
homeobox protein DLX-6
Protein Family
NCBI Description
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. [provided by RefSeq, Jul 2008]
Research Articles on DLX6
Similar Products
Product Notes
The DLX6 (Catalog #AAA6130955) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DLX6 (Homeobox Protein DLX-6) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DLX6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DLX6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DLX6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
