Mouse DLX5 Monoclonal Antibody | anti-DLX5 antibody

DLX5 (Distal-less Homeobox 5) (PE)

Cat. Num. AAA6185202

• Gene Names: DLX5; SHFM1D
• Applications: Immunofluorescence
• Purity: Purified
• Synonyms: DLX5; Monoclonal Antibody; DLX5 (Distal-less Homeobox 5) (PE); Distal-less Homeobox 5; anti-DLX5 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H6
• Specificity: Recognizes DLX5.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-DLX5 antibody: Immunofluorescence (IF)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: DLX5 (NP_005212, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNR*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged DLX5 is approximately 0.3ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DLX5 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DLX5 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-DLX5 antibody

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. [provided by RefSeq]

Product Categories/Family for anti-DLX5 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 4885187
• NCBI GeneID: 1749
• NCBI Accession #: NP_005212
• NCBI GenBank Nucleotide #: NM_005221
• UniProt Accession #: P56178
• Molecular Weight: 32kDa
• NCBI Official Full Name: homeobox protein DLX-5
• NCBI Official Synonym Full Names: distal-less homeobox 5
• NCBI Official Symbol: DLX5
• NCBI Official Synonym Symbols: SHFM1D
• NCBI Protein Information: homeobox protein DLX-5
• UniProt Protein Name: Homeobox protein DLX-5
• Protein Family: Homeobox protein
• UniProt Gene Name: DLX5
• UniProt Entry Name: DLX5_HUMAN

NCBI Description

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. [provided by RefSeq, Jul 2008]

Uniprot Description

DLX5: Transcriptional factor involved in bone development. Acts as an immediate early BMP-responsive transcriptional activator essential for osteoblast differentiation. Stimulates ALPL promoter activity in a RUNX2-independent manner during osteoblast differentiation. Stimulates SP7 promoter activity during osteoblast differentiation. Promotes cell proliferation by up-regulating MYC promoter activity. Involved as a positive regulator of both chondrogenesis and chondrocyte hypertrophy in the endochondral skeleton. Binds to the homeodomain-response element of the ALPL and SP7 promoter. Binds to the MYC promoter. Requires the 5'-TAATTA-3' consensus sequence for DNA-binding. Defects in DLX5 are the cause of split-hand/foot malformation type 1, with sensorineural hearing loss (SHFM1D). A disease characterized by the association of split- hand/foot malformation with deafness. Split-hand/foot malformation is a limb malformation involving the central rays of the autopod and presenting with syndactyly, median clefts of the hands and feet, and aplasia and/or hypoplasia of the phalanges, metacarpals, and metatarsals. Some patients have been found to have mental retardation, ectodermal and craniofacial findings, and orofacial clefting. Belongs to the distal-less homeobox family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 7q22

Cellular Component: cytoplasm; nuclear chromatin

Biological Process: nervous system development; axon guidance; inner ear morphogenesis; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; olfactory pit development; palate development; BMP signaling pathway; osteoblast differentiation; cell proliferation; positive regulation of osteoblast differentiation; epithelial cell differentiation; anatomical structure formation; skeletal development; positive regulation of epithelial cell proliferation; embryonic limb morphogenesis; endochondral ossification

Disease: Split-hand/foot Malformation 1 With Sensorineural Hearing Loss, Autosomal Recessive