Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (47.34kD).)

Mouse anti-Human DIP2A Monoclonal Antibody | anti-DIP2A antibody

DIP2A (Disco-interacting Protein 2 Homolog A, DIP2 Homolog A, C21orf106, DIP2, KIAA0184) (FITC)

Gene Names
DIP2A; DIP2; C21orf106
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DIP2A; Monoclonal Antibody; DIP2A (Disco-interacting Protein 2 Homolog A; DIP2 Homolog A; C21orf106; DIP2; KIAA0184) (FITC); anti-DIP2A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E6
Specificity
Recognizes human DIP2A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-DIP2A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa107-301 from DIP2A (NP_055966) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KYKERKMPMPSKRRSVLVHSSVETYTPPDTSSASEDEGSLRRPGRLTSTPLQSHSSVEPWLDRVIQGSSTSSSASSTSSHPGGRPTTAPSAAATPGAAATTALAGLEAHTHIDLHSAPPDVTTGLVEHSYFERPQVASVRSVPRGCSGSMLETADGVPVNSRVSSKIQQLLNTLKRPKRPPLKEFFVDDFEELLE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (47.34kD).)

Western Blot (WB) (Western Blot detection against Immunogen (47.34kD).)

Western Blot (WB)

(Western Blot analysis of DIP2A expression in transfected 293T cell line by DIP2A monoclonal antibody. Lane 1: DIP2A transfected lysate (Predicted MW: 170.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DIP2A expression in transfected 293T cell line by DIP2A monoclonal antibody. Lane 1: DIP2A transfected lysate (Predicted MW: 170.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged DIP2A is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DIP2A is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-DIP2A antibody
DIP2A may provide positional cues for axon pathfinding and patterning in the central nervous system.
Product Categories/Family for anti-DIP2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
170kDa
NCBI Official Full Name
disco-interacting protein 2 homolog A isoform a
NCBI Official Synonym Full Names
disco interacting protein 2 homolog A
NCBI Official Symbol
DIP2A
NCBI Official Synonym Symbols
DIP2; C21orf106
NCBI Protein Information
disco-interacting protein 2 homolog A
UniProt Protein Name
Disco-interacting protein 2 homolog A
Protein Family
UniProt Gene Name
DIP2A
UniProt Synonym Gene Names
C21orf106; DIP2; KIAA0184; DIP2 homolog A
UniProt Entry Name
DIP2A_HUMAN

NCBI Description

The protein encoded by this gene may be involved in axon patterning in the central nervous system. This gene is not highly expressed. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Research Articles on DIP2A

Similar Products

Product Notes

The DIP2A dip2a (Catalog #AAA6146849) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DIP2A (Disco-interacting Protein 2 Homolog A, DIP2 Homolog A, C21orf106, DIP2, KIAA0184) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DIP2A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DIP2A dip2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DIP2A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.