Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DHH monoclonal antibody. Western Blot analysis of DHH expression in human colon.)

Mouse anti-Human DHH Monoclonal Antibody | anti-DHH antibody

DHH (Desert Hedgehog Protein, HHG-3, MGC35145) (PE)

Gene Names
DHH; GDXYM; HHG-3; SRXY7
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DHH; Monoclonal Antibody; DHH (Desert Hedgehog Protein; HHG-3; MGC35145) (PE); anti-DHH antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F10
Specificity
Recognizes human DHH.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-DHH antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa210-310 from human DHH (NP_066382) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGERKGLRELHRGDWVLAADASGRVVPTPVLLFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPGGDALRP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(DHH monoclonal antibody. Western Blot analysis of DHH expression in human colon.)

Western Blot (WB) (DHH monoclonal antibody. Western Blot analysis of DHH expression in human colon.)
Related Product Information for anti-DHH antibody
Intercellular signal essential for a variety of patterning events during development. May function as a spermatocyte survival factor in the testes. Essential for testes development.
Product Categories/Family for anti-DHH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa (197aa), confirmed by MALDI-TOF.
NCBI Official Full Name
desert hedgehog protein preproprotein
NCBI Official Synonym Full Names
desert hedgehog
NCBI Official Symbol
DHH
NCBI Official Synonym Symbols
GDXYM; HHG-3; SRXY7
NCBI Protein Information
desert hedgehog protein
UniProt Protein Name
Desert hedgehog protein
Protein Family
UniProt Gene Name
DHH
UniProt Synonym Gene Names
DHH
UniProt Entry Name
DHH_HUMAN

NCBI Description

This gene encodes a member of the hedgehog family. The hedgehog gene family encodes signaling molecules that play an important role in regulating morphogenesis. This protein is predicted to be made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the organism. Defects in this protein have been associated with partial gonadal dysgenesis (PGD) accompanied by minifascicular polyneuropathy. This protein may be involved in both male gonadal differentiation and perineurial development. [provided by RefSeq, May 2010]

Uniprot Description

DHH: Intercellular signal essential for a variety of patterning events during development. May function as a spermatocyte survival factor in the testes. Essential for testes development. Defects in DHH may be the cause of partial gonadal dysgenesis with minifascicular neuropathy 46,XY (PGD). PGD is characterized by the presence of a testis on one side and a streak or an absent gonad at the other, persistence of Muellerian duct structures, and a variable degree of genital ambiguity. Defects in DHH may be the cause of complete pure gonadal dysgenesis 46,XY type (GDXYM); also known as male- limited gonadal dysgenesis 46,XY. GDXYM is a type of hypogonadism in which no functional gonads are present to induce puberty in an externally female person whose karyotype is then found to be XY. The gonads are found to be non-functional streaks. Belongs to the hedgehog family.

Protein type: Secreted, signal peptide; Secreted; Cell development/differentiation

Chromosomal Location of Human Ortholog: 12q13.1

Cellular Component: extracellular space; plasma membrane

Molecular Function: peptidase activity; protein binding; zinc ion binding; patched binding; calcium ion binding

Biological Process: myelination; Leydig cell differentiation; cell-cell signaling; male sex determination; regulation of steroid biosynthetic process; proteolysis; spermatid development; response to estradiol stimulus

Disease: 46,xy Gonadal Dysgenesis, Partial, With Minifascicular Neuropathy; 46,xy Sex Reversal 7

Research Articles on DHH

Similar Products

Product Notes

The DHH dhh (Catalog #AAA6157442) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DHH (Desert Hedgehog Protein, HHG-3, MGC35145) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHH can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DHH dhh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DHH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.