Mouse DHH Monoclonal Antibody | anti-DHH antibody

DHH (desert Hedgehog Homolog (Drosophila), HHG-3, MGC35145) (PE)

Cat. Num. AAA6186586

• Gene Names: DHH; GDXYM; HHG-3; SRXY7
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: DHH; Monoclonal Antibody; DHH (desert Hedgehog Homolog (Drosophila); HHG-3; MGC35145) (PE); desert Hedgehog Homolog (Drosophila); MGC35145; anti-DHH antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G10
• Specificity: Recognizes DHH.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-DHH antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: DHH (NP_066382, 210aa-310aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SGERKGLRELHRGDWVLAADASGRVVPTPVLLFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPGGDALRP*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(DHH monoclonal antibody (M06), clone 3G10. Western Blot analysis of DHH expression in human colon.)

Related Product Information for anti-DHH antibody

This gene encodes a member of the Hedgehog family. The hedgehog gene family encodes signaling molecules that play an important role in regulating morphogenesis. This protein is predicted to be made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the organism. Defects in this protein have been associated with partial gonadal dysgenesis (PGD) accompanied by minifascicular polyneuropathy. This protein may be involved in both male gonadal differentiation and perineurial development. [provided by RefSeq]

Product Categories/Family for anti-DHH antibody

Antibodies; Stem Cell Research

NCBI and Uniprot Product Information

• NCBI GI #: 19482158
• NCBI GeneID: 50846
• NCBI Accession #: NP_066382
• NCBI GenBank Nucleotide #: NM_021044.3
• UniProt Accession #: O43323; Q15794
• Molecular Weight: 22kDa (197aa), confirmed by MALDI-TOF.
• NCBI Official Full Name: desert hedgehog protein preproprotein
• NCBI Official Synonym Full Names: desert hedgehog
• NCBI Official Symbol: DHH
• NCBI Official Synonym Symbols: GDXYM; HHG-3; SRXY7
• NCBI Protein Information: desert hedgehog protein
• UniProt Protein Name: Desert hedgehog protein
• Protein Family: Desert hedgehog protein
• UniProt Gene Name: DHH
• UniProt Synonym Gene Names: DHH
• UniProt Entry Name: DHH_HUMAN

NCBI Description

This gene encodes a member of the hedgehog family. The hedgehog gene family encodes signaling molecules that play an important role in regulating morphogenesis. This protein is predicted to be made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the organism. Defects in this protein have been associated with partial gonadal dysgenesis (PGD) accompanied by minifascicular polyneuropathy. This protein may be involved in both male gonadal differentiation and perineurial development. [provided by RefSeq, May 2010]

Uniprot Description

DHH: Intercellular signal essential for a variety of patterning events during development. May function as a spermatocyte survival factor in the testes. Essential for testes development. Defects in DHH may be the cause of partial gonadal dysgenesis with minifascicular neuropathy 46,XY (PGD). PGD is characterized by the presence of a testis on one side and a streak or an absent gonad at the other, persistence of Muellerian duct structures, and a variable degree of genital ambiguity. Defects in DHH may be the cause of complete pure gonadal dysgenesis 46,XY type (GDXYM); also known as male- limited gonadal dysgenesis 46,XY. GDXYM is a type of hypogonadism in which no functional gonads are present to induce puberty in an externally female person whose karyotype is then found to be XY. The gonads are found to be non-functional streaks. Belongs to the hedgehog family.

Protein type: Secreted, signal peptide; Secreted; Cell development/differentiation

Chromosomal Location of Human Ortholog: 12q13.1

Cellular Component: extracellular space; plasma membrane

Molecular Function: peptidase activity; protein binding; zinc ion binding; patched binding; calcium ion binding

Biological Process: myelination; Leydig cell differentiation; cell-cell signaling; male sex determination; regulation of steroid biosynthetic process; proteolysis; spermatid development; response to estradiol stimulus

Disease: 46,xy Gonadal Dysgenesis, Partial, With Minifascicular Neuropathy; 46,xy Sex Reversal 7