Mouse anti-Human DGAT2 Monoclonal Antibody | anti-DGAT2 antibody

DGAT2 (Diacylglycerol O-acyltransferase 2, Acyl-CoA Retinol O-fatty-acyltransferase, ARAT, Retinol O-fatty-acyltransferase, Diglyceride Acyltransferase 2, HMFN1045, UNQ738/PRO1433, DKFZp686A15125) (FITC)

Cat. Num. AAA6146828

• Gene Names: DGAT2; ARAT; HMFN1045; GS1999FULL
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DGAT2; Monoclonal Antibody; DGAT2 (Diacylglycerol O-acyltransferase 2; Acyl-CoA Retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride Acyltransferase 2; HMFN1045; UNQ738/PRO1433; DKFZp686A15125) (FITC); anti-DGAT2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C1
• Specificity: Recognizes human DGAT2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-DGAT2 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa289-389 from human DGAT2 (NP_115953) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-DGAT2 antibody

Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation. In liver, is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides. Functions also as an acyl-CoA retinol acyltransferase (ARAT).

Product Categories/Family for anti-DGAT2 antibody

Antibodies; Enzymes; Acyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 26024197
• NCBI GeneID: 84649
• NCBI Accession #: NP_115953.2
• NCBI GenBank Nucleotide #: NM_032564
• UniProt Accession #: Q96PD7; Q5U810; Q68CL3; Q68DJ0; Q8NDB7; Q96BS0; Q9BYE5; A6ND76
• Molecular Weight: 43,831 Da
• NCBI Official Full Name: diacylglycerol O-acyltransferase 2 isoform 1
• NCBI Official Synonym Full Names: diacylglycerol O-acyltransferase 2
• NCBI Official Symbol: DGAT2
• NCBI Official Synonym Symbols: ARAT; HMFN1045; GS1999FULL
• NCBI Protein Information: diacylglycerol O-acyltransferase 2; diglyceride acyltransferase 2; retinol O-fatty-acyltransferase; acyl-CoA retinol O-fatty-acyltransferase; diacylglycerol O-acyltransferase homolog 2; diacylglycerol O-acyltransferase-like protein 2
• UniProt Protein Name: Diacylglycerol O-acyltransferase 2
• Protein Family: Diacylglycerol O-acyltransferase
• UniProt Gene Name: DGAT2
• UniProt Synonym Gene Names: ARAT; Retinol O-fatty-acyltransferase
• UniProt Entry Name: DGAT2_HUMAN

NCBI Description

This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

DGAT2: Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation. In liver, is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides. Functions also as an acyl-CoA retinol acyltransferase (ARAT). Belongs to the diacylglycerol acyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transferase; EC 2.3.1.76; Membrane protein, multi-pass; Lipid Metabolism - glycerolipid; Cofactor and Vitamin Metabolism - retinol; EC 2.3.1.20

Chromosomal Location of Human Ortholog: 11q13.5

Cellular Component: endoplasmic reticulum membrane; mitochondrion; perinuclear region of cytoplasm; endoplasmic reticulum; integral to membrane; integral to endoplasmic reticulum membrane; lipid particle

Molecular Function: 2-acylglycerol O-acyltransferase activity; protein homodimerization activity; retinol O-fatty-acyltransferase activity; diacylglycerol O-acyltransferase activity

Biological Process: sequestering of lipid; cholesterol homeostasis; retinol metabolic process; glycerol metabolic process; phospholipid metabolic process; fatty acid homeostasis; glycerophospholipid biosynthetic process; triacylglycerol biosynthetic process; diacylglycerol metabolic process; cellular lipid metabolic process