Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged DFNA5 is 3ng/ml as a capture antibody.)

Mouse anti-Human DFNA5 Monoclonal Antibody | anti-DFNA5 antibody

DFNA5 (Non-syndromic Hearing Impairment Protein 5, Inversely Correlated With Estrogen Receptor Expression 1, ICERE-1, ICERE1) APC

Gene Names
GSDME; DFNA5; ICERE-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DFNA5; Monoclonal Antibody; DFNA5 (Non-syndromic Hearing Impairment Protein 5; Inversely Correlated With Estrogen Receptor Expression 1; ICERE-1; ICERE1) APC; anti-DFNA5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E10
Specificity
Recognizes human DFNA5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-DFNA5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa111-200 from human DFNA5 (NP_004394) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGN
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged DFNA5 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DFNA5 is 3ng/ml as a capture antibody.)
Product Categories/Family for anti-DFNA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,043 Da
NCBI Official Full Name
gasdermin-E isoform a
NCBI Official Synonym Full Names
gasdermin E
NCBI Official Symbol
GSDME
NCBI Official Synonym Symbols
DFNA5; ICERE-1
NCBI Protein Information
gasdermin-E
UniProt Protein Name
Non-syndromic hearing impairment protein 5
UniProt Gene Name
DFNA5
UniProt Synonym Gene Names
ICERE1
UniProt Entry Name
DFNA5_HUMAN

NCBI Description

Hearing impairment is a heterogeneous condition with over 40 loci described. The protein encoded by this gene is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in this gene. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DFNA5: Involved in apoptosis and cell survival. Plays a role in the TP53-regulated cellular response to DNA damage probably by cooperating with TP53. Defects in DFNA5 are the cause of deafness autosomal dominant type 5 (DFNA5). DFNA5 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Is a tumor suppressor gene with an important role in major types of tumors. Could be a valuable molecular marker in cancer. Belongs to the gasdermin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor

Chromosomal Location of Human Ortholog: 7p15

Cellular Component: cytoplasm

Biological Process: negative regulation of cell proliferation; sensory perception of sound; inner ear receptor cell differentiation; apoptosis

Disease: Deafness, Autosomal Dominant 5

Research Articles on DFNA5

Similar Products

Product Notes

The DFNA5 dfna5 (Catalog #AAA6136220) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DFNA5 (Non-syndromic Hearing Impairment Protein 5, Inversely Correlated With Estrogen Receptor Expression 1, ICERE-1, ICERE1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DFNA5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DFNA5 dfna5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DFNA5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.