Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human DECR1 Monoclonal Antibody | anti-DECR1 antibody

DECR1 (2,4 Dienoyl CoA Reductase 1 Mitochondrial, DECR, Short Chain Dehydrogenase/reductase Family 18C Member 1, SDR18C1) (HRP)

Gene Names
DECR1; DECR; NADPH; SDR18C1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DECR1; Monoclonal Antibody; DECR1 (2; 4 Dienoyl CoA Reductase 1 Mitochondrial; DECR; Short Chain Dehydrogenase/reductase Family 18C Member 1; SDR18C1) (HRP); anti-DECR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D4
Specificity
Recognizes human DECR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DECR1 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is 0.3ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa236-335 from human DECR1 (NP_001350) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(DECR1 monoclonal antibody Western Blot analysis of DECR1 expression in HepG2.)

Western Blot (WB) (DECR1 monoclonal antibody Western Blot analysis of DECR1 expression in HepG2.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DECR1 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to DECR1 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DECR1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DECR1 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-DECR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,994 Da
NCBI Official Full Name
2,4-dienoyl-CoA reductase, mitochondrial isoform 1
NCBI Official Synonym Full Names
2,4-dienoyl-CoA reductase 1
NCBI Official Symbol
DECR1
NCBI Official Synonym Symbols
DECR; NADPH; SDR18C1
NCBI Protein Information
2,4-dienoyl-CoA reductase, mitochondrial
UniProt Protein Name
2,4-dienoyl-CoA reductase, mitochondrial
Protein Family
UniProt Gene Name
DECR1
UniProt Synonym Gene Names
DECR; SDR18C1; 4-enoyl-CoA reductase [NADPH]
UniProt Entry Name
DECR_HUMAN

NCBI Description

This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters. [provided by RefSeq, Jul 2008]

Uniprot Description

DECR1: Auxiliary enzyme of beta-oxidation. It participates in the metabolism of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3- enoyl-CoA. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.

Protein type: Oxidoreductase; Mitochondrial; EC 1.3.1.34

Chromosomal Location of Human Ortholog: 8q21.3

Cellular Component: nucleoplasm; mitochondrion; mitochondrial matrix; cytoplasm; nucleus

Molecular Function: oxidoreductase activity, acting on NADH or NADPH; 2,4-dienoyl-CoA reductase (NADPH) activity

Biological Process: fatty acid beta-oxidation; cellular lipid metabolic process; protein homotetramerization

Research Articles on DECR1

Similar Products

Product Notes

The DECR1 decr1 (Catalog #AAA6152116) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DECR1 (2,4 Dienoyl CoA Reductase 1 Mitochondrial, DECR, Short Chain Dehydrogenase/reductase Family 18C Member 1, SDR18C1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DECR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Sandwich ELISA: The detection limit is 0.3ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DECR1 decr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DECR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.