Mouse anti-Human DECR1 Monoclonal Antibody | anti-DECR1 antibody

DECR1 (2,4 Dienoyl CoA Reductase 1 Mitochondrial, DECR, Short Chain Dehydrogenase/reductase Family 18C Member 1, SDR18C1) (HRP)

Cat. Num. AAA6152116

• Gene Names: DECR1; DECR; NADPH; SDR18C1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DECR1; Monoclonal Antibody; DECR1 (2; 4 Dienoyl CoA Reductase 1 Mitochondrial; DECR; Short Chain Dehydrogenase/reductase Family 18C Member 1; SDR18C1) (HRP); anti-DECR1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3D4
• Specificity: Recognizes human DECR1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-DECR1 antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is 0.3ng/ml as a capture antibody; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa236-335 from human DECR1 (NP_001350) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(DECR1 monoclonal antibody Western Blot analysis of DECR1 expression in HepG2.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DECR1 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DECR1 is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-DECR1 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 4503301
• NCBI GeneID: 1666
• NCBI Accession #: NP_001350
• NCBI GenBank Nucleotide #: NM_001359
• UniProt Accession #: Q16698; Q2M304; Q93085; B7Z6B8
• Molecular Weight: 34,994 Da
• NCBI Official Full Name: 2,4-dienoyl-CoA reductase, mitochondrial isoform 1
• NCBI Official Synonym Full Names: 2,4-dienoyl-CoA reductase 1
• NCBI Official Symbol: DECR1
• NCBI Official Synonym Symbols: DECR; NADPH; SDR18C1
• NCBI Protein Information: 2,4-dienoyl-CoA reductase, mitochondrial
• UniProt Protein Name: 2,4-dienoyl-CoA reductase, mitochondrial
• Protein Family: 2,4-dienoyl-CoA reductase
• UniProt Gene Name: DECR1
• UniProt Synonym Gene Names: DECR; SDR18C1; 4-enoyl-CoA reductase [NADPH]
• UniProt Entry Name: DECR_HUMAN

NCBI Description

This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters. [provided by RefSeq, Jul 2008]

Uniprot Description

DECR1: Auxiliary enzyme of beta-oxidation. It participates in the metabolism of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3- enoyl-CoA. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.

Protein type: Oxidoreductase; Mitochondrial; EC 1.3.1.34

Chromosomal Location of Human Ortholog: 8q21.3

Cellular Component: nucleoplasm; mitochondrion; mitochondrial matrix; cytoplasm; nucleus

Molecular Function: oxidoreductase activity, acting on NADH or NADPH; 2,4-dienoyl-CoA reductase (NADPH) activity

Biological Process: fatty acid beta-oxidation; cellular lipid metabolic process; protein homotetramerization