Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged DDX4 is 0.3 ng/ml as a capture antibody.)

Mouse DDX4 Monoclonal Antibody | anti-DDX4 antibody

DDX4 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 4, MGC111074, VASA) (Biotin)

Applications
Western Blot
Purity
Purified
Synonyms
DDX4; Monoclonal Antibody; DDX4 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 4; MGC111074; VASA) (Biotin); DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 4; VASA; anti-DDX4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D5
Specificity
Recognizes DDX4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-DDX4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DDX4 (NP_061912.1, 625aa-724aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDDESWD
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged DDX4 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DDX4 is 0.3 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of DDX4 expression in transfected 293T cell line by DDX4 monoclonal antibody (M06), clone 3D5.Lane 1: DDX4 transfected lysate (Predicted MW: 75.8 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DDX4 expression in transfected 293T cell line by DDX4 monoclonal antibody (M06), clone 3D5.Lane 1: DDX4 transfected lysate (Predicted MW: 75.8 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-DDX4 antibody
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a homolog of VASA proteins in Drosophila and several other species. The gene is specifically expressed in the germ cell lineage in both sexes and functions in germ cell development. [provided by RefSeq]
Product Categories/Family for anti-DDX4 antibody

NCBI and Uniprot Product Information

NCBI GI #

Similar Products

Product Notes

The DDX4 (Catalog #AAA6174630) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DDX4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDX4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDX4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.