Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to DDX3Y on formalin-fixed paraffin-embedded human testis.)

Mouse anti-Human, Mouse DDX3Y Monoclonal Antibody | anti-DDX3Y antibody

DDX3Y (DBY, ATP-dependent RNA Helicase DDX3Y, DEAD Box Protein 3, Y-chromosomal) APC

Gene Names
DDX3Y; DBY
Reactivity
Human, Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DDX3Y; Monoclonal Antibody; DDX3Y (DBY; ATP-dependent RNA Helicase DDX3Y; DEAD Box Protein 3; Y-chromosomal) APC; anti-DDX3Y antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D7
Specificity
Recognizes human DDX3Y. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-DDX3Y antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-80 from DDX3Y (NP_004651) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to DDX3Y on formalin-fixed paraffin-embedded human testis.)

Testing Data (Immunoperoxidase of monoclonal antibody to DDX3Y on formalin-fixed paraffin-embedded human testis.)

Western Blot (WB)

(DDX3Y monoclonal antibody Western Blot analysis of DDX3Y expression in NIH/3T3.)

Western Blot (WB) (DDX3Y monoclonal antibody Western Blot analysis of DDX3Y expression in NIH/3T3.)

Western Blot (WB)

(DDX3Y monoclonal antibody Western Blot analysis of DDX3Y expression in mouse testis.)

Western Blot (WB) (DDX3Y monoclonal antibody Western Blot analysis of DDX3Y expression in mouse testis.)

Western Blot (WB)

(DDX3Y monoclonal antibody Western Blot analysis of DDX3Y expression in HeLa.)

Western Blot (WB) (DDX3Y monoclonal antibody Western Blot analysis of DDX3Y expression in HeLa.)
Product Categories/Family for anti-DDX3Y antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32,416 Da
NCBI Official Full Name
ATP-dependent RNA helicase DDX3Y isoform 1
NCBI Official Synonym Full Names
DEAD (Asp-Glu-Ala-Asp) box helicase 3, Y-linked
NCBI Official Symbol
DDX3Y
NCBI Official Synonym Symbols
DBY
NCBI Protein Information
ATP-dependent RNA helicase DDX3Y

NCBI Description

The protein encoded by this gene is a member of the DEAD-box RNA helicase family, characterized by nine conserved motifs, included the conserved Asp-Glu-Ala-Asp (DEAD) motif. These motifs are thought to be involved in ATP binding, hydrolysis, RNA binding, and in the formation of intramolecular interactions. This protein shares high similarity to DDX3X, on the X chromosome, but a deletion of this gene is not complemented by DDX3X. Mutations in this gene result in male infertility, a reduction in germ cell numbers, and can result in Sertoli-cell only sydrome. Pseudogenes sharing similarity to both this gene and the DDX3X paralog are found on chromosome 4 and the X chromosome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]

Research Articles on DDX3Y

Similar Products

Product Notes

The DDX3Y (Catalog #AAA6136200) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DDX3Y (DBY, ATP-dependent RNA Helicase DDX3Y, DEAD Box Protein 3, Y-chromosomal) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DDX3Y can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDX3Y for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDX3Y, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.