Mouse anti-Human, Mouse DDX3Y Monoclonal Antibody | anti-DDX3Y antibody

DDX3Y (DBY, ATP-dependent RNA Helicase DDX3Y, DEAD Box Protein 3, Y-chromosomal) APC

Cat. Num. AAA6136200

• Gene Names: DDX3Y; DBY
• Reactivity: Human, Mouse
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DDX3Y; Monoclonal Antibody; DDX3Y (DBY; ATP-dependent RNA Helicase DDX3Y; DEAD Box Protein 3; Y-chromosomal) APC; anti-DDX3Y antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2D7
• Specificity: Recognizes human DDX3Y. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-DDX3Y antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-80 from DDX3Y (NP_004651) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGK
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to DDX3Y on formalin-fixed paraffin-embedded human testis.)

Western Blot (WB)

(DDX3Y monoclonal antibody Western Blot analysis of DDX3Y expression in NIH/3T3.)

Western Blot (WB)

(DDX3Y monoclonal antibody Western Blot analysis of DDX3Y expression in mouse testis.)

Western Blot (WB)

(DDX3Y monoclonal antibody Western Blot analysis of DDX3Y expression in HeLa.)

Product Categories/Family for anti-DDX3Y antibody

Antibodies; DEAD Box Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13514809
• NCBI GeneID: 8653
• NCBI Accession #: NP_004651
• NCBI GenBank Nucleotide #: NM_004660
• Molecular Weight: 32,416 Da
• NCBI Official Full Name: ATP-dependent RNA helicase DDX3Y isoform 1
• NCBI Official Synonym Full Names: DEAD (Asp-Glu-Ala-Asp) box helicase 3, Y-linked
• NCBI Official Symbol: DDX3Y
• NCBI Official Synonym Symbols: DBY
• NCBI Protein Information: ATP-dependent RNA helicase DDX3Y
• Protein Family: ATP-dependent RNA helicase

NCBI Description

The protein encoded by this gene is a member of the DEAD-box RNA helicase family, characterized by nine conserved motifs, included the conserved Asp-Glu-Ala-Asp (DEAD) motif. These motifs are thought to be involved in ATP binding, hydrolysis, RNA binding, and in the formation of intramolecular interactions. This protein shares high similarity to DDX3X, on the X chromosome, but a deletion of this gene is not complemented by DDX3X. Mutations in this gene result in male infertility, a reduction in germ cell numbers, and can result in Sertoli-cell only sydrome. Pseudogenes sharing similarity to both this gene and the DDX3X paralog are found on chromosome 4 and the X chromosome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]