Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DDX20 Monoclonal Antibody | anti-DDX20 antibody

DDX20 (DP103, GEMIN3, Probable ATP-dependent RNA Helicase DDX20, Component of Gems 3, DEAD Box Protein 20, DEAD Box Protein DP 103, Gemin-3) (MaxLight 750)

Gene Names
DDX20; DP103; GEMIN3
Reactivity
Human
Applications
Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DDX20; Monoclonal Antibody; DDX20 (DP103; GEMIN3; Probable ATP-dependent RNA Helicase DDX20; Component of Gems 3; DEAD Box Protein 20; DEAD Box Protein DP 103; Gemin-3) (MaxLight 750); anti-DDX20 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5H5
Specificity
Recognizes human DDX20.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-DDX20 antibody
FLISA, Immunofluorescence (IF)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa725-825 from DDX20 (NP_009135) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ*
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-DDX20 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,272 Da
NCBI Official Full Name
probable ATP-dependent RNA helicase DDX20
NCBI Official Synonym Full Names
DEAD (Asp-Glu-Ala-Asp) box polypeptide 20
NCBI Official Symbol
DDX20
NCBI Official Synonym Symbols
DP103; GEMIN3
NCBI Protein Information
probable ATP-dependent RNA helicase DDX20; DEAD box protein 20; DEAD box protein DP 103; DEAD-box protein DP103; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 20, 103kD; SMN-interacting protein; component of gems 3; gemin-3
UniProt Protein Name
Probable ATP-dependent RNA helicase DDX20
UniProt Gene Name
DDX20
UniProt Synonym Gene Names
DP103; GEMIN3
UniProt Entry Name
DDX20_HUMAN

Uniprot Description

GEMIN3: an ubiquitous DEAD box protein, which has an ATPase activity and is a component of the survival of motor neurons (SMN) complex. Interacts directly with SMN, the spinal muscular atrophy gene product, and may play a catalytic role in the function of the SMN complex on RNPs. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp, are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.

Protein type: EC 3.6.4.13; Helicase; RNA splicing; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 1p21.1-p13.2

Cellular Component: nucleoplasm; cytoskeleton; transcriptional repressor complex; membrane; cytoplasm; SMN complex; nucleus; cytosol

Molecular Function: protein domain specific binding; protein binding; DNA binding; ATP binding; ATP-dependent RNA helicase activity

Biological Process: RNA processing; assembly of spliceosomal tri-snRNP; oogenesis; spliceosomal snRNP biogenesis; positive regulation of apoptosis; regulation of steroid biosynthetic process; gene expression; negative regulation of transcription from RNA polymerase II promoter

Similar Products

Product Notes

The DDX20 ddx20 (Catalog #AAA6232458) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DDX20 (DP103, GEMIN3, Probable ATP-dependent RNA Helicase DDX20, Component of Gems 3, DEAD Box Protein 20, DEAD Box Protein DP 103, Gemin-3) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDX20 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDX20 ddx20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDX20, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.