Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DDOST Monoclonal Antibody | anti-DDOST antibody

DDOST (Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase 48kD Subunit, Oligosaccharyl Transferase 48kD Subunit, DDOST 48kD Subunit, KIAA0115, OST48, OK/SW-cl.45) (MaxLight 550)

Gene Names
DDOST; OST; WBP1; AGER1; CDG1R; OST48; OKSWcl45
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DDOST; Monoclonal Antibody; DDOST (Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase 48kD Subunit; Oligosaccharyl Transferase 48kD Subunit; DDOST 48kD Subunit; KIAA0115; OST48; OK/SW-cl.45) (MaxLight 550); anti-DDOST antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D7
Specificity
Recognizes human DDOST.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-DDOST antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa328-427 from human DDOST (NP_005207) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DDOST antibody
DDOST encodes a component of the oligosaccharyltransferase complex which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues on nascent polypeptides in the lumen of the rough endoplasmic reticulum. The protein complex co-purifies with ribosomes. The product of this gene is also implicated in the processing of advanced glycation endproducts (AGEs), which form from non-enzymatic reactions between sugars and proteins or lipids and are associated with aging and hyperglycemia.
Product Categories/Family for anti-DDOST antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,020 Da
NCBI Official Full Name
dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
NCBI Official Synonym Full Names
dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic)
NCBI Official Symbol
DDOST
NCBI Official Synonym Symbols
OST; WBP1; AGER1; CDG1R; OST48; OKSWcl45
NCBI Protein Information
dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit; advanced glycation endproduct receptor 1; dolichyl-diphosphooligosaccharide-protein glycotransferase; oligosaccharyl transferase 48 kDa subunit; oligosaccharyltransferase 48 kD
UniProt Protein Name
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
UniProt Gene Name
DDOST
UniProt Synonym Gene Names
KIAA0115; OST48; DDOST 48 kDa subunit; Oligosaccharyl transferase 48 kDa subunit
UniProt Entry Name
OST48_HUMAN

Similar Products

Product Notes

The DDOST ddost (Catalog #AAA6211104) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DDOST (Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase 48kD Subunit, Oligosaccharyl Transferase 48kD Subunit, DDOST 48kD Subunit, KIAA0115, OST48, OK/SW-cl.45) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDOST can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDOST ddost for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDOST, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.