Mouse anti-Human DBF4 Monoclonal Antibody | anti-DBF4 antibody

DBF4 (Protein DBF4 Homolog A, Activator of S Phase Kinase, DBF4-type Zinc Finger-containing Protein 1, Chiffon Homolog A, ASK, DBF4A, ZDBF1) APC

Cat. Num. AAA6136170

• Gene Names: DBF4; ASK; CHIF; DBF4A; ZDBF1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DBF4; Monoclonal Antibody; DBF4 (Protein DBF4 Homolog A; Activator of S Phase Kinase; DBF4-type Zinc Finger-containing Protein 1; Chiffon Homolog A; ASK; DBF4A; ZDBF1) APC; anti-DBF4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6G9
• Specificity: Recognizes human DBF4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 674

• Applicable Applications for anti-DBF4 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2-99 from human DBF4 (NP_006707) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQT
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB)

(Western Blot analysis of DBF4 expression in transfected 293T cell line by DBF4 monoclonal antibody Lane 1: DBF4 transfected lysate (76.9kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DBF4 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DBF4 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-DBF4 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 5729734
• NCBI GeneID: 10926
• NCBI Accession #: NP_006707
• NCBI GenBank Nucleotide #: NM_006716
• UniProt Accession #: Q9UBU7
• NCBI Official Full Name: protein DBF4 homolog A isoform 1
• NCBI Official Synonym Full Names: DBF4 zinc finger
• NCBI Official Symbol: DBF4
• NCBI Official Synonym Symbols: ASK; CHIF; DBF4A; ZDBF1
• NCBI Protein Information: protein DBF4 homolog A
• UniProt Protein Name: Protein DBF4 homolog A
• Protein Family: DDK kinase regulatory
• UniProt Gene Name: DBF4
• UniProt Synonym Gene Names: ASK; DBF4A; ZDBF1
• UniProt Entry Name: DBF4A_HUMAN

Uniprot Description

DBF4: DBF4

Protein type: Cell cycle regulation; Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 7q21.3

Cellular Component: nucleoplasm

Molecular Function: nucleic acid binding; zinc ion binding; enzyme activator activity

Biological Process: positive regulation of catalytic activity; mitotic cell cycle; DNA replication; G1/S transition of mitotic cell cycle