Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DAZAP2 expression in transfected 293T cell line by DAZAP2 monoclonal antibody (M06), clone 8G5.Lane 1: DAZAP2 transfected lysate (Predicted MW: 17.3 KDa).Lane 2: Non-transfected lysate.)

Mouse DAZAP2 Monoclonal Antibody | anti-DAZAP2 antibody

DAZAP2 (DAZ Associated Protein 2, KIAA0058, MGC14319, MGC766, PRTB) (FITC)

Gene Names
DAZAP2; PRTB
Applications
Western Blot
Purity
Purified
Synonyms
DAZAP2; Monoclonal Antibody; DAZAP2 (DAZ Associated Protein 2; KIAA0058; MGC14319; MGC766; PRTB) (FITC); DAZ Associated Protein 2; PRTB; anti-DAZAP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8G5
Specificity
Recognizes DAZAP2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
168
Applicable Applications for anti-DAZAP2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DAZAP2 (NP_055579.1, 1aa-168aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DAZAP2 expression in transfected 293T cell line by DAZAP2 monoclonal antibody (M06), clone 8G5.Lane 1: DAZAP2 transfected lysate (Predicted MW: 17.3 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DAZAP2 expression in transfected 293T cell line by DAZAP2 monoclonal antibody (M06), clone 8G5.Lane 1: DAZAP2 transfected lysate (Predicted MW: 17.3 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB)

(DAZAP2 monoclonal antibody (M06), clone 8G5. Western Blot analysis of DAZAP2 expression in HeLa.)

Western Blot (WB) (DAZAP2 monoclonal antibody (M06), clone 8G5. Western Blot analysis of DAZAP2 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged DAZAP2 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DAZAP2 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-DAZAP2 antibody
This gene encodes a proline-rich protein which interacts with the deleted in azoospermia (DAZ) and the deleted in azoospermia-like gene through the DAZ-like repeats. This protein also interacts with the transforming growth factor-beta signaling molecule SARA (Smad anchor for receptor activation), eukaryotic initiation factor 4G, and an E3 ubiquitinase that regulates its stability in splicing factor containing nuclear speckles. The encoded protein may function in various biological and pathological processes including spermatogenesis, cell signaling and transcription regulation, formation of stress granules during translation arrest, RNA splicing, and pathogenesis of multiple myeloma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-DAZAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
DAZ-associated protein 2 isoform a
NCBI Official Synonym Full Names
DAZ associated protein 2
NCBI Official Symbol
DAZAP2
NCBI Official Synonym Symbols
PRTB
NCBI Protein Information
DAZ-associated protein 2
UniProt Protein Name
DAZ-associated protein 2
Protein Family
UniProt Gene Name
DAZAP2
UniProt Synonym Gene Names
KIAA0058
UniProt Entry Name
DAZP2_HUMAN

NCBI Description

This gene encodes a proline-rich protein which interacts with the deleted in azoospermia (DAZ) and the deleted in azoospermia-like gene through the DAZ-like repeats. This protein also interacts with the transforming growth factor-beta signaling molecule SARA (Smad anchor for receptor activation), eukaryotic initiation factor 4G, and an E3 ubiquitinase that regulates its stability in splicing factor containing nuclear speckles. The encoded protein may function in various biological and pathological processes including spermatogenesis, cell signaling and transcription regulation, formation of stress granules during translation arrest, RNA splicing, and pathogenesis of multiple myeloma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

DAZAP2: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 12q12

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; WW domain binding

Research Articles on DAZAP2

Similar Products

Product Notes

The DAZAP2 dazap2 (Catalog #AAA6178960) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DAZAP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DAZAP2 dazap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DAZAP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.