Mouse anti-Human DAZAP1 Monoclonal Antibody | anti-DAZAP1 antibody

DAZAP1 (DAZ-associated Protein 1, Deleted In Azoospermia-associated Protein 1) (PE)

Cat. Num. AAA6157380

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DAZAP1; Monoclonal Antibody; DAZAP1 (DAZ-associated Protein 1; Deleted In Azoospermia-associated Protein 1) (PE); anti-DAZAP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F6
• Specificity: Recognizes human DAZAP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 2184

• Applicable Applications for anti-DAZAP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa308-408 from human DAZAP1 (NP_061832) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of DAZAP1 expression in transfected 293T cell line by DAZAP1 monoclonal antibody Lane 1: DAZAP1 transfected lysate (Predicted MW: 43.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged DAZAP1 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-DAZAP1 antibody

DAZAP1 is a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL.

Product Categories/Family for anti-DAZAP1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1677501782
• NCBI GeneID: 26528
• NCBI Accession #: NM_018959.4
• NCBI GenBank Nucleotide #: NM_018959
• UniProt Accession #: Q96EP5
• NCBI Official Full Name: Homo sapiens DAZ associated protein 1 (DAZAP1), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: DAZ associated protein 1
• NCBI Official Symbol: DAZAP1
• NCBI Protein Information: DAZ-associated protein 1
• UniProt Protein Name: DAZ-associated protein 1
• Protein Family: DAZ-associated protein
• UniProt Gene Name: DAZAP1
• UniProt Entry Name: DAZP1_HUMAN

NCBI Description

In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene. [provided by RefSeq, Jul 2008]