Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (45.8kD).)

Mouse anti-Human Cytohesin 3 Monoclonal Antibody | anti-CYTH3 antibody

Cytohesin 3 (Cytohesin-3, CYTH3, ARF Nucleotide-binding Site Opener 3, ARNO3, Protein ARNO3, General Receptor of Phosphoinositides 1, Grp1, PH, SEC7 and Coiled-coil Domain-containing Protein 3, PSCD3) (HRP)

Gene Names
CYTH3; GRP1; ARNO3; PSCD3; cytohesin-3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cytohesin 3; Monoclonal Antibody; Cytohesin 3 (Cytohesin-3; CYTH3; ARF Nucleotide-binding Site Opener 3; ARNO3; Protein ARNO3; General Receptor of Phosphoinositides 1; Grp1; PH; SEC7 and Coiled-coil Domain-containing Protein 3; PSCD3) (HRP); anti-CYTH3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
6D3-1A9
Specificity
Recognizes human PSCD3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CYTH3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-180 from PSCD3 (AAH08191) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (45.8kD).)

Western Blot (WB) (Western Blot detection against Immunogen (45.8kD).)

Western Blot (WB)

(Western Blot analysis of PSCD3 expression in transfected 293T cell line by PSCD3 monoclonal antibody. Lane 1: PSCD3 transfected lysate (46.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PSCD3 expression in transfected 293T cell line by PSCD3 monoclonal antibody. Lane 1: PSCD3 transfected lysate (46.3kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PSCD3 on HeLa cell. [antibody concentration 10ug/ml)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PSCD3 on HeLa cell. [antibody concentration 10ug/ml)

Testing Data

(Detection limit for recombinant GST tagged PSCD3 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PSCD3 is ~3ng/ml as a capture antibody.)

Western Blot (WB)

(PSCD3 monoclonal antibody Western Blot analysis of PSCD3 expression in Hela NE)

Western Blot (WB) (PSCD3 monoclonal antibody Western Blot analysis of PSCD3 expression in Hela NE)
Product Categories/Family for anti-CYTH3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
46,292 Da
NCBI Official Full Name
Homo sapiens cytohesin 3, mRNA
NCBI Official Synonym Full Names
cytohesin 3
NCBI Official Symbol
CYTH3
NCBI Official Synonym Symbols
GRP1; ARNO3; PSCD3; cytohesin-3
NCBI Protein Information
cytohesin-3
Protein Family

NCBI Description

This gene encodes a member of the PSCD (pleckstrin homology, Sec7 and coiled-coil domains) family. PSCD family members have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This encoded protein is involved in the control of Golgi structure and function, and it may have a physiological role in regulating ADP-ribosylation factor protein 6 (ARF) functions, in addition to acting on ARF1. [provided by RefSeq, Jul 2008]

Research Articles on CYTH3

Similar Products

Product Notes

The CYTH3 (Catalog #AAA6154389) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Cytohesin 3 (Cytohesin-3, CYTH3, ARF Nucleotide-binding Site Opener 3, ARNO3, Protein ARNO3, General Receptor of Phosphoinositides 1, Grp1, PH, SEC7 and Coiled-coil Domain-containing Protein 3, PSCD3) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cytohesin 3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYTH3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cytohesin 3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.