Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human CYLC1 Monoclonal Antibody | anti-CYLC1 antibody

CYLC1 (Cylicin-1, Cylicin I, Multiple-band Polypeptide I, CYL, CYL1)

Gene Names
CYLC1; CYCL1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CYLC1; Monoclonal Antibody; CYLC1 (Cylicin-1; Cylicin I; Multiple-band Polypeptide I; CYL; CYL1); Anti -CYLC1 (Cylicin-1; anti-CYLC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6F12
Specificity
Recognizes human CYLC1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SSKTGFKTSTKIKGSDTESEESLYKPGAKKKIDESDGTSANSKMEGLESKRGFRMSSKKTTFNEKGEKASTGRVPPSREKPPLPACEPSLPSPKVRRLCW
Applicable Applications for anti-CYLC1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa526-625 from human CYLC1 (XP_088636.6) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged CYLC1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CYLC1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-CYLC1 antibody
Possible architectural role during spermatogenesis. May be involved in spermatid differentiation.
Product Categories/Family for anti-CYLC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
74,242 Da
NCBI Official Full Name
CYLC1 protein, partial
NCBI Official Synonym Full Names
cylicin, basic protein of sperm head cytoskeleton 1
NCBI Official Symbol
CYLC1
NCBI Official Synonym Symbols
CYCL1
NCBI Protein Information
cylicin-1; cylicin I; multiple-band polypeptide I
UniProt Protein Name
Cylicin-1
Protein Family
UniProt Gene Name
CYLC1
UniProt Synonym Gene Names
CYL; CYL1
UniProt Entry Name
CYLC1_HUMAN

NCBI Description

This gene encodes a sperm head cytoskeletal protein. The encoded protein is associated with the calyx of spermatozoa and spermatids. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]

Uniprot Description

CYLC1: Possible architectural role during spermatogenesis. May be involved in spermatid differentiation.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: Xq21.1

Cellular Component: nucleus; acrosomal matrix

Molecular Function: structural constituent of cytoskeleton; structural molecule activity

Biological Process: multicellular organismal development; spermatogenesis; cell differentiation

Research Articles on CYLC1

Similar Products

Product Notes

The CYLC1 cylc1 (Catalog #AAA6001864) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CYLC1 (Cylicin-1, Cylicin I, Multiple-band Polypeptide I, CYL, CYL1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYLC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the CYLC1 cylc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SSKTGFKTST KIKGSDTESE ESLYKPGAKK KIDESDGTSA NSKMEGLESK RGFRMSSKKT TFNEKGEKAS TGRVPPSREK PPLPACEPSL PSPKVRRLCW. It is sometimes possible for the material contained within the vial of "CYLC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.