Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CCNG1 is ~10ng/ml as a capture antibody.)

Mouse anti-Human Cyclin G1 Monoclonal Antibody | anti-CYCG1 antibody

Cyclin G1 (Cyclin-G1, Cyclin-G, CCNG1, CCNG, CYCG1) APC

Gene Names
CCNG1; CCNG
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cyclin G1; Monoclonal Antibody; Cyclin G1 (Cyclin-G1; Cyclin-G; CCNG1; CCNG; CYCG1) APC; anti-CYCG1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E3
Specificity
Recognizes human CCNG1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CYCG1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human CCNG1 (AAH00196) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CCNG1 is ~10ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CCNG1 is ~10ng/ml as a capture antibody.)
Related Product Information for anti-CYCG1 antibody
Cyclin G contains a typical N-terminal cyclin box and a carboxy terminal domain sequence homologous to the tyrosine phosphorylation site of the epidermal growth factor receptor. Cyclin G2 shares 53% aa sequence identity with cyclin G1. Peak expression of cyclin G2 is seen in late S phase, as opposed to cyclin G1 expression, which is constitutive.
Product Categories/Family for anti-CYCG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
900
Molecular Weight
18,769 Da
NCBI Official Full Name
Homo sapiens cyclin G1, mRNA
NCBI Official Synonym Full Names
cyclin G1
NCBI Official Symbol
CCNG1
NCBI Official Synonym Symbols
CCNG
NCBI Protein Information
cyclin-G1

NCBI Description

The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The protein encoded by this gene is a member of the cyclin family and contains the cyclin box. The encoded protein lacks the protein destabilizing (PEST) sequence that is present in other family members. Transcriptional activation of this gene can be induced by tumor protein p53. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008]

Research Articles on CYCG1

Similar Products

Product Notes

The CYCG1 (Catalog #AAA6136129) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Cyclin G1 (Cyclin-G1, Cyclin-G, CCNG1, CCNG, CYCG1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cyclin G1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYCG1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cyclin G1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.