Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Cyclin B1 Monoclonal Antibody | anti-CCNB1 antibody

Cyclin B1 (G2/Mitotic-specific Cyclin-B1, CCNB1, CCNB) (MaxLight 750)

Gene Names
CCNB1; CCNB
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cyclin B1; Monoclonal Antibody; Cyclin B1 (G2/Mitotic-specific Cyclin-B1; CCNB1; CCNB) (MaxLight 750); anti-CCNB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Clone Number
1C8
Specificity
Recognizes human CCNB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-CCNB1 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from human CCNB1 (NP_114172) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLV
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-CCNB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
891
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50.9 kDa (457aa)
NCBI Official Full Name
G2/mitotic-specific cyclin-B1 isoform 1
NCBI Official Synonym Full Names
cyclin B1
NCBI Official Symbol
CCNB1
NCBI Official Synonym Symbols
CCNB
NCBI Protein Information
G2/mitotic-specific cyclin-B1
UniProt Protein Name
G2/mitotic-specific cyclin-B1
UniProt Gene Name
CCNB1
UniProt Synonym Gene Names
CCNB
UniProt Entry Name
CCNB1_HUMAN

NCBI Description

The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the cell cycle. [provided by RefSeq, Aug 2017]

Uniprot Description

CCNB1: a member of the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Complexes with cdc2 to form the maturation-promoting factor (MPF). Two alternatively spliced isoforms have been found, a constitutively expressed form and a cell cycle-regulated form that is expressed predominantly during G2/M phase.

Protein type: Activator; Cell cycle regulation

Chromosomal Location of Human Ortholog: 5q12

Cellular Component: nucleoplasm; spindle pole; centrosome; membrane; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; patched binding; histone kinase activity; protein kinase binding

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; positive regulation of histone phosphorylation; regulation of cell cycle; ventricular cardiac muscle cell development; positive regulation of attachment of spindle microtubules to kinetochore; mitotic nuclear envelope disassembly; positive regulation of mRNA 3'-end processing; positive regulation of mitotic cell cycle; positive regulation of fibroblast proliferation; negative regulation of protein amino acid phosphorylation; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; tissue regeneration; protein complex assembly; G2/M transition of mitotic cell cycle; positive regulation of cardiac muscle cell proliferation; response to drug; in utero embryonic development; oocyte maturation; mitotic metaphase plate congression; response to DDT; gut development; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; response to mechanical stimulus; cell division; spermatogenesis; regulation of cyclin-dependent protein kinase activity; mitotic cell cycle; mitotic spindle stabilization; G1/S transition of mitotic cell cycle

Research Articles on CCNB1

Similar Products

Product Notes

The CCNB1 ccnb1 (Catalog #AAA6232387) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Cyclin B1 (G2/Mitotic-specific Cyclin-B1, CCNB1, CCNB) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cyclin B1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCNB1 ccnb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cyclin B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.