Mouse CXCL12 Monoclonal Antibody | anti-CXCL12 antibody

CXCL12 (Chemokine (C-X-C Motif) Ligand 12 (Stromal Cell-Derived Factor 1), PBSF, SCYB12, SDF-1a, SDF-1b, SDF1, SDF1A, SDF1B, TLSF-a, TLSF-b, TPAR1) (Biotin)

Cat. Num. AAA6170549

• Gene Names: CXCL12; IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12
• Applications: ELISA
• Purity: Purified
• Synonyms: CXCL12; Monoclonal Antibody; CXCL12 (Chemokine (C-X-C Motif) Ligand 12 (Stromal Cell-Derived Factor 1); PBSF; SCYB12; SDF-1a; SDF-1b; SDF1; SDF1A; SDF1B; TLSF-a; TLSF-b; TPAR1) (Biotin); Chemokine (C-X-C Motif) Ligand 12 (Stromal Cell-Derived Factor 1); TPAR1; anti-CXCL12 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1F10
• Specificity: Recognizes CXCL12.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CXCL12 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CXCL12 (AAH39893.1, 1aa-89aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CXCL12 is approximately 1ng/ml as a capture antibody.)

Related Product Information for anti-CXCL12 antibody

For background information on chemokines, see CXCL1 (MIM 155730). Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF (see MIM 191160), or IL1 (see MIM 147760). The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group. [supplied by OMIM]

Product Categories/Family for anti-CXCL12 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 25058964
• NCBI GeneID: 6387
• Molecular Weight: 11,004 Da
• NCBI Official Full Name: Chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
• NCBI Official Synonym Full Names: C-X-C motif chemokine ligand 12
• NCBI Official Symbol: CXCL12
• NCBI Official Synonym Symbols: IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12
• NCBI Protein Information: stromal cell-derived factor 1
• Protein Family: Stromal cell-derived factor

NCBI Description

This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]