Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.07kD).)

Mouse anti-Human CSTF3 Monoclonal Antibody | anti-CSTF3 antibody

CSTF3 (Cleavage Stimulation Factor Subunit 3, CF-1 77kD Subunit, Cleavage Stimulation Factor 77kD Subunit, CSTF 77kD Subunit, CstF-77) (Biotin)

Gene Names
CSTF3; CSTF-77
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CSTF3; Monoclonal Antibody; CSTF3 (Cleavage Stimulation Factor Subunit 3; CF-1 77kD Subunit; Cleavage Stimulation Factor 77kD Subunit; CSTF 77kD Subunit; CstF-77) (Biotin); anti-CSTF3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D4
Specificity
Recognizes human CSTF3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CSTF3 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-103 from human CSTF3 (AAH09792) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.07kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.07kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CSTF3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CSTF3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CSTF3 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CSTF3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CSTF3 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CSTF3 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of CSTF3 over-expressed 293 cell line, cotransfected with CSTF3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CSTF3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of CSTF3 over-expressed 293 cell line, cotransfected with CSTF3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CSTF3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(Western Blot analysis of CSTF3 expression in transfected 293T cell line by CSTF3 monoclonal antibody. Lane 1: CSTF3 transfected lysate (11.44kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CSTF3 expression in transfected 293T cell line by CSTF3 monoclonal antibody. Lane 1: CSTF3 transfected lysate (11.44kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-CSTF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
4,952 Da
NCBI Official Full Name
Homo sapiens cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa, mRNA
NCBI Official Synonym Full Names
cleavage stimulation factor subunit 3
NCBI Official Symbol
CSTF3
NCBI Official Synonym Symbols
CSTF-77
NCBI Protein Information
cleavage stimulation factor subunit 3

NCBI Description

The protein encoded by this gene is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The encoded protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Research Articles on CSTF3

Similar Products

Product Notes

The CSTF3 (Catalog #AAA6141391) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CSTF3 (Cleavage Stimulation Factor Subunit 3, CF-1 77kD Subunit, Cleavage Stimulation Factor 77kD Subunit, CSTF 77kD Subunit, CstF-77) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSTF3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CSTF3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSTF3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.