Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CSPG5 is 0.03 ng/ml as a capture antibody.)

Mouse CSPG5 Monoclonal Antibody | anti-CSPG5 antibody

CSPG5 (Chondroitin Sulfate Proteoglycan 5 (neuroglycan C), MGC44034, NGC) (HRP)

Gene Names
CSPG5; NGC
Applications
Western Blot
Purity
Purified
Synonyms
CSPG5; Monoclonal Antibody; CSPG5 (Chondroitin Sulfate Proteoglycan 5 (neuroglycan C); MGC44034; NGC) (HRP); Chondroitin Sulfate Proteoglycan 5 (neuroglycan C); NGC; anti-CSPG5 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4G6
Specificity
Recognizes CSPG5.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CSPG5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CSPG5 (NP_006565, 445aa-539aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CSPG5 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CSPG5 is 0.03 ng/ml as a capture antibody.)
Product Categories/Family for anti-CSPG5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
chondroitin sulfate proteoglycan 5 isoform 1
NCBI Official Synonym Full Names
chondroitin sulfate proteoglycan 5
NCBI Official Symbol
CSPG5
NCBI Official Synonym Symbols
NGC
NCBI Protein Information
chondroitin sulfate proteoglycan 5
UniProt Protein Name
Chondroitin sulfate proteoglycan 5
UniProt Gene Name
CSPG5
UniProt Synonym Gene Names
CALEB; NGC
UniProt Entry Name
CSPG5_HUMAN

NCBI Description

The protein encoded by this gene is a proteoglycan that may function as a neural growth and differentiation factor. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

Uniprot Description

CSPG5: May function as a growth and differentiation factor involved in neuritogenesis. May induce ERBB3 activation. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: Golgi apparatus; lysosomal lumen; endoplasmic reticulum membrane; membrane; Golgi lumen; integral to plasma membrane; extracellular region; integral to membrane

Molecular Function: protein binding; growth factor activity

Biological Process: chondroitin sulfate metabolic process; regulation of synaptic transmission; nervous system development; chondroitin sulfate biosynthetic process; intracellular transport; glycosaminoglycan metabolic process; axon regeneration; regulation of growth; carbohydrate metabolic process; chondroitin sulfate catabolic process; pathogenesis; dermatan sulfate biosynthetic process

Research Articles on CSPG5

Similar Products

Product Notes

The CSPG5 cspg5 (Catalog #AAA6182768) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CSPG5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CSPG5 cspg5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSPG5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.