Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between TP53 and CSNK1E. HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and CSNK1E mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Mouse anti-Human CSNK1E Monoclonal Antibody | anti-CSNK1E antibody

CSNK1E (Casein Kinase I, epsilon Isoform, CKI-epsilon, CKIe) APC

Gene Names
CSNK1E; CKIe; HCKIE; CKIepsilon
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CSNK1E; Monoclonal Antibody; CSNK1E (Casein Kinase I; epsilon Isoform; CKI-epsilon; CKIe) APC; anti-CSNK1E antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E1
Specificity
Recognizes human CSNK1E.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
416
Applicable Applications for anti-CSNK1E antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-100 from human CSNK1E (NP_689407) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKF
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between TP53 and CSNK1E. HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and CSNK1E mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between TP53 and CSNK1E. HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and CSNK1E mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-CSNK1E antibody
CK1e is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. This protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. It has been shown to phosphorylate period, a circadian rhythm protein.
Product Categories/Family for anti-CSNK1E antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
casein kinase I isoform epsilon
NCBI Official Synonym Full Names
casein kinase 1 epsilon
NCBI Official Symbol
CSNK1E
NCBI Official Synonym Symbols
CKIe; HCKIE; CKIepsilon
NCBI Protein Information
casein kinase I isoform epsilon
UniProt Protein Name
Casein kinase I isoform epsilon
Protein Family
UniProt Gene Name
CSNK1E
UniProt Synonym Gene Names
CKI-epsilon; CKIe
UniProt Entry Name
KC1E_HUMAN

NCBI Description

The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Feb 2014]

Uniprot Description

CK1E: an ubiquitous protein kinase of the CK1 family. Together with Dvl-1 and Frat-1 activate the Wnt signaling pathway. Central component of the circadian clock. May act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. May play a role in cell cycle progression. Two splice variant isoforms have been described. Component of the circadian core oscillator, which includes the CRY proteins, CLOCK, or NPAS2, BMAL1 or BMAL2, CK1-D and/or CK1-E, TIMELESS and the PER proteins. Interacts directly with PER1 and PER2 which may lead to their degradation. Interacts with SOCS3. Mutations in hamster and Drosophila orthologs have circadian rhythm phenotypes, and the circadian gene period (per) is a substrate in both human and fly. A coding SNP variant in human, which increases CK1 activity, is negatively associated with circadian disorder. LOF mutations and LOH seen in mammary ductal carcinoma.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; Protein kinase, CK1; CK1 group; CK1 family

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: cytoplasm; cytosol; nucleus; ribonucleoprotein complex

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding; protein kinase activity

Biological Process: circadian rhythm; Wnt receptor signaling pathway; negative regulation of Wnt receptor signaling pathway; organelle organization and biogenesis; endocytosis; regulation of circadian rhythm; DNA repair; signal transduction; protein amino acid phosphorylation; regulation of cell shape; peptidyl-serine phosphorylation; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; mitotic cell cycle; circadian regulation of gene expression; G2/M transition of mitotic cell cycle

Research Articles on CSNK1E

Similar Products

Product Notes

The CSNK1E csnk1e (Catalog #AAA6136077) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CSNK1E (Casein Kinase I, epsilon Isoform, CKI-epsilon, CKIe) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSNK1E can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CSNK1E csnk1e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSNK1E, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.