Mouse anti-Human CSF1 Monoclonal Antibody | anti-CSF1 antibody

CSF1 (Macrophage Colony-stimulating Factor 1, CSF-1, M-CSF, MCSF, Lanimostim) (Biotin)

Cat. Num. AAA6141377

• Gene Names: CSF1; MCSF; CSF-1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CSF1; Monoclonal Antibody; CSF1 (Macrophage Colony-stimulating Factor 1; CSF-1; M-CSF; MCSF; Lanimostim) (Biotin); anti-CSF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A9
• Specificity: Recognizes human CSF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CSF1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa33-132 from human CSF1 (AAH21117) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of CSF1 expression in transfected 293T cell line by CSF1 monoclonal antibody. Lane 1: CSF1 transfected lysate (60.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CSF1 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-CSF1 antibody

Macrophage Colony Stimulating Factor (M-CSF) is produced by various cell types, including fibroblasts, microphages, and endothelial cells. M-CSF is involved in both the development and function of monocytes/microphages.

Product Categories/Family for anti-CSF1 antibody

Antibodies; Growth Factors; Cytokines

References

1. Pathway-Based Biomarker Search by High-Throughput Proteomics Profiling of Secretomes. Lawlor K, Nazarian A, Lacomis L, Tempst P, Villanueva J.J Proteome Res. 2009 Mar;8(3):1489-503.

NCBI and Uniprot Product Information

• NCBI GI #: 18088910
• NCBI GeneID: 1435
• Molecular Weight: 29,215 Da
• NCBI Official Full Name: Homo sapiens colony stimulating factor 1 (macrophage), mRNA
• NCBI Official Synonym Full Names: colony stimulating factor 1
• NCBI Official Symbol: CSF1
• NCBI Official Synonym Symbols: MCSF; CSF-1
• NCBI Protein Information: macrophage colony-stimulating factor 1
• Protein Family: Protein

NCBI Description

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]