Mouse anti-Human CRY1 Monoclonal Antibody | anti-CRY1 antibody

CRY1 (Cryptochrome-1, PHLL1) (FITC)

Cat. Num. AAA6146669

• Gene Names: CRY1; PHLL1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CRY1; Monoclonal Antibody; CRY1 (Cryptochrome-1; PHLL1) (FITC); anti-CRY1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4H4-1C4
• Specificity: Recognizes human CRY1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-CRY1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-586 from human CRY1 (AAH30519) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (90.2kD).)

Western Blot (WB)

(CRY1 monoclonal antibody, Western Blot analysis of CRY1 expression in HeLa NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CRY1 on formalin-fixed paraffin-embedded human colon adenocarcinoma tissue. [antibody concentration 5ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CRY1 on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-CRY1 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 22539646
• NCBI GeneID: 1407
• Molecular Weight: 66,395 Da
• NCBI Official Full Name: Homo sapiens cryptochrome 1 (photolyase-like), mRNA
• NCBI Official Synonym Full Names: cryptochrome circadian clock 1
• NCBI Official Symbol: CRY1
• NCBI Official Synonym Symbols: PHLL1
• NCBI Protein Information: cryptochrome-1
• Protein Family: Cryptochrome

NCBI Description

This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness. [provided by RefSeq, Jan 2014]