Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (51.37kD).)

Mouse anti-Human CRSP9 Monoclonal Antibody | anti-CRSP9 antibody

CRSP9 (ARC34, Mediator of RNA Polymerase II Transcription Subunit 7, Activator-recruited Cofactor 34kD Component, Cofactor Required for Sp1 Transcriptional Activation Subunit 9, Mediator Complex Subunit 7, RNA Polymerase Transcriptional Regulation Mediato

Gene Names
MED7; ARC34; CRSP9; CRSP33
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CRSP9; Monoclonal Antibody; CRSP9 (ARC34; Mediator of RNA Polymerase II Transcription Subunit 7; Activator-recruited Cofactor 34kD Component; Cofactor Required for Sp1 Transcriptional Activation Subunit 9; Mediator Complex Subunit 7; RNA Polymerase Transcriptional Regulation Mediato; anti-CRSP9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3E7
Specificity
Recognizes human CRSP9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CRSP9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-233 from CRSP9 (AAH05250) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (51.37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (51.37kD).)

Western Blot (WB)

(CRSP9 monoclonal antibody Western Blot analysis of CRSP9 expression in Jurkat.)

Western Blot (WB) (CRSP9 monoclonal antibody Western Blot analysis of CRSP9 expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged CRSP9 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CRSP9 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of CRSP9 expression in transfected 293T cell line by CRSP9 monoclonal antibody. Lane 1: CRSP9 transfected lysate (27.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CRSP9 expression in transfected 293T cell line by CRSP9 monoclonal antibody. Lane 1: CRSP9 transfected lysate (27.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of CRSP9 over-expressed 293 cell line, cotransfected with CRSP9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CRSP9 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of CRSP9 over-expressed 293 cell line, cotransfected with CRSP9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CRSP9 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-CRSP9 antibody
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq].
Product Categories/Family for anti-CRSP9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
27,245 Da
NCBI Official Full Name
Homo sapiens mediator complex subunit 7, mRNA
NCBI Official Synonym Full Names
mediator complex subunit 7
NCBI Official Symbol
MED7
NCBI Official Synonym Symbols
ARC34; CRSP9; CRSP33
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 7

NCBI Description

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Similar Products

Product Notes

The CRSP9 (Catalog #AAA6130757) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CRSP9 (ARC34, Mediator of RNA Polymerase II Transcription Subunit 7, Activator-recruited Cofactor 34kD Component, Cofactor Required for Sp1 Transcriptional Activation Subunit 9, Mediator Complex Subunit 7, RNA Polymerase Transcriptional Regulation Mediato reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRSP9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRSP9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRSP9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.