Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CRSP3 Monoclonal Antibody | anti-CRSP3 antibody

CRSP3 (Mediator of RNA Polymerase II Transcription Subunit 23, Activator-recruited Cofactor 130kD Component, ARC130, Cofactor Required for Sp1 Transcriptional Activation Subunit 3, CRSP Complex Subunit 3, Mediator Complex Subunit 23, Protein Sur-2 Homolog

Gene Names
MED23; SUR2; CRSP3; MRT18; SUR-2; ARC130; CRSP130; CRSP133; DRIP130
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CRSP3; Monoclonal Antibody; CRSP3 (Mediator of RNA Polymerase II Transcription Subunit 23; Activator-recruited Cofactor 130kD Component; ARC130; Cofactor Required for Sp1 Transcriptional Activation Subunit 3; CRSP Complex Subunit 3; Mediator Complex Subunit 23; Protein Sur-2 Homolog; anti-CRSP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H6
Specificity
Recognizes human CRSP3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CRSP3 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa531-630 from CRSP3 (NP_004821) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LTVHAKMSLIHSIATRVIKLAHAKSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CRSP3 antibody
Required for transcriptional activation subsequent to the assembly of the preinitiation complex By similarity. Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for transcriptional activation by adenovirus E1A protein. Required for ELK1-dependent transcriptional activation in response to activated Ras signaling.
Product Categories/Family for anti-CRSP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
156kDa
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 23 isoform a
NCBI Official Synonym Full Names
mediator complex subunit 23
NCBI Official Symbol
MED23
NCBI Official Synonym Symbols
SUR2; CRSP3; MRT18; SUR-2; ARC130; CRSP130; CRSP133; DRIP130
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 23
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 23
UniProt Gene Name
MED23
UniProt Synonym Gene Names
ARC130; CRSP3; DRIP130; KIAA1216; SUR2; ARC130; CRSP complex subunit 3; hSur-2; DRIP130
UniProt Entry Name
MED23_HUMAN

NCBI Description

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein also acts as a metastasis suppressor. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

MED23: Required for transcriptional activation subsequent to the assembly of the preinitiation complex. Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for transcriptional activation by adenovirus E1A protein. Required for ELK1-dependent transcriptional activation in response to activated Ras signaling. Defects in MED23 are the cause of mental retardation autosomal recessive type 18 (MRT18). Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Belongs to the Mediator complex subunit 23 family. 5 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 6q22.33-q24.1

Cellular Component: nucleoplasm; transcription factor complex; Srb-mediator complex

Molecular Function: protein binding; transcription coactivator activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; regulation of transcription, DNA-dependent; gene expression

Disease: Mental Retardation, Autosomal Recessive 18

Research Articles on CRSP3

Similar Products

Product Notes

The CRSP3 med23 (Catalog #AAA6221644) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CRSP3 (Mediator of RNA Polymerase II Transcription Subunit 23, Activator-recruited Cofactor 130kD Component, ARC130, Cofactor Required for Sp1 Transcriptional Activation Subunit 3, CRSP Complex Subunit 3, Mediator Complex Subunit 23, Protein Sur-2 Homolog reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRSP3 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRSP3 med23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRSP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.