Western Blot (WB)
(CRLF1 monoclonal antibody (M02), clone 5C2. Western Blot analysis of CRLF1 expression in HeLa (Cat # L013V1).)
Mouse CRLF1 Monoclonal Antibody | anti-CRLF1 antibody
CRLF1 (Cytokine Receptor-like Factor 1, CISS, CISS1, CLF, CLF-1, NR6) (FITC)
Gene Names
CRLF1; CLF; NR6; CISS; CISS1; CLF-1; zcytor5
Applications
Western Blot
Purity
Purified
Synonyms
CRLF1; Monoclonal Antibody; CRLF1 (Cytokine Receptor-like Factor 1; CISS; CISS1; CLF; CLF-1; NR6) (FITC); Cytokine Receptor-like Factor 1; NR6; anti-CRLF1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5C2
Specificity
Recognizes CRLF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CRLF1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CRLF1 (NP_004741, 135aa-230aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDIL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(CRLF1 monoclonal antibody (M02), clone 5C2. Western Blot analysis of CRLF1 expression in HeLa (Cat # L013V1).)
Western Blot (WB)
(CRLF1 monoclonal antibody (M02), clone 5C2. Western Blot analysis of CRLF1 expression in HeLa (Cat # L013V1).)
Testing Data
(Detection limit for recombinant GST tagged CRLF1 is approximately 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged CRLF1 is approximately 1ng/ml as a capture antibody.)
Related Product Information for anti-CRLF1 antibody
Mouse monoclonal antibody raised against a partial recombinant CRLF1.
Product Categories/Family for anti-CRLF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,302 Da
NCBI Official Full Name
cytokine receptor-like factor 1
NCBI Official Synonym Full Names
cytokine receptor-like factor 1
NCBI Official Symbol
CRLF1
NCBI Official Synonym Symbols
CLF; NR6; CISS; CISS1; CLF-1; zcytor5
NCBI Protein Information
cytokine receptor-like factor 1; class I cytokine receptor; cytokine type 1 receptor CRLP-1; cytokine-like factor 1
UniProt Protein Name
Cytokine receptor-like factor 1
Protein Family
UniProt Gene Name
CRLF1
UniProt Synonym Gene Names
CLF-1
UniProt Entry Name
CRLF1_HUMAN
Similar Products
Product Notes
The CRLF1 crlf1 (Catalog #AAA6177044) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CRLF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRLF1 crlf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRLF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
