Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human CRKL Monoclonal Antibody | anti-CRKL antibody

CRKL (Crk-like Protein) (HRP)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CRKL; Monoclonal Antibody; CRKL (Crk-like Protein) (HRP); anti-CRKL antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B5
Specificity
Recognizes human CRKL.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CRKL antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa204-303 from human CRKL (NP_005198) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CRKL on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CRKL on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CRKL is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CRKL is ~0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GAB1 and CRKL. HeLa cells were stained with GAB1 rabbit purified polyclonal 1:1200 and CRKL mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between GAB1 and CRKL. HeLa cells were stained with GAB1 rabbit purified polyclonal 1:1200 and CRKL mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PTK2 and CRKL. Huh7 cells were stained with PTK2 rabbit purified polyclonal 1:600 and CRKL mouse monoclonal antibody 1:100. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between PTK2 and CRKL. Huh7 cells were stained with PTK2 rabbit purified polyclonal 1:600 and CRKL mouse monoclonal antibody 1:100. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)

Western Blot (WB)

(Western Blot analysis of CRKL expression in transfected 293T cell line by CRKL monoclonal antibody. Lane 1: CRKL transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CRKL expression in transfected 293T cell line by CRKL monoclonal antibody. Lane 1: CRKL transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of CRKL over-expressed 293 cell line, cotransfected with CRKL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CRKL monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of CRKL over-expressed 293 cell line, cotransfected with CRKL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CRKL monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-CRKL antibody
This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic.
Product Categories/Family for anti-CRKL antibody
References
1. PI3K Links NKG2D Signaling to a CrkL Pathway Involved in Natural Killer Cell Adhesion, Polarity, and Granule Secretion. Segovis CM, Schoon RA, Dick CJ, Nacusi LP, Leibson PJ, Billadeau DD.J Immunol. 2009 Jun 1;182(11):6933-42.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.9 kDa (323aa), confirmed by MALDI-TOF
NCBI Official Full Name
crk-like protein
NCBI Official Synonym Full Names
CRK like proto-oncogene, adaptor protein
NCBI Official Symbol
CRKL
NCBI Protein Information
crk-like protein
UniProt Protein Name
Crk-like protein
Protein Family
UniProt Gene Name
CRKL
UniProt Entry Name
CRKL_HUMAN

NCBI Description

This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic.[provided by RefSeq, Jan 2009]

Uniprot Description

CRKL: an oncogenic adaptor protein with an SH2-SH3-SH3 domain structure. Plays a specific role in integrin-induced migration as a downstream mediator of Src. Activates the RAS and Jnk signaling pathways. Transforms fibroblasts in a RAS-dependent fashion. A substrate of BCR-ABL and plays a role in fibroblast transformation by BCR-ABL.

Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: cytosol; endosome

Molecular Function: protein binding; signal transducer activity; SH3/SH2 adaptor activity

Biological Process: anterior/posterior pattern formation; blood vessel development; organ morphogenesis; nerve growth factor receptor signaling pathway; activation of MAPKK activity; thymus development; heart development; Ras protein signal transduction; JNK cascade; parathyroid gland development

Research Articles on CRKL

Similar Products

Product Notes

The CRKL crkl (Catalog #AAA6151963) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CRKL (Crk-like Protein) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRKL can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRKL crkl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRKL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.