Mouse anti-Human CRKL Monoclonal Antibody | anti-CRKL antibody

CRKL (Crk-like Protein) (HRP)

Cat. Num. AAA6151963

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CRKL; Monoclonal Antibody; CRKL (Crk-like Protein) (HRP); anti-CRKL antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4B5
• Specificity: Recognizes human CRKL.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CRKL antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa204-303 from human CRKL (NP_005198) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CRKL on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CRKL is ~0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GAB1 and CRKL. HeLa cells were stained with GAB1 rabbit purified polyclonal 1:1200 and CRKL mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PTK2 and CRKL. Huh7 cells were stained with PTK2 rabbit purified polyclonal 1:600 and CRKL mouse monoclonal antibody 1:100. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)

Western Blot (WB)

(Western Blot analysis of CRKL expression in transfected 293T cell line by CRKL monoclonal antibody. Lane 1: CRKL transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of CRKL over-expressed 293 cell line, cotransfected with CRKL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CRKL monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-CRKL antibody

This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic.

Product Categories/Family for anti-CRKL antibody

Antibodies; Disease Markers

References

1. PI3K Links NKG2D Signaling to a CrkL Pathway Involved in Natural Killer Cell Adhesion, Polarity, and Granule Secretion. Segovis CM, Schoon RA, Dick CJ, Nacusi LP, Leibson PJ, Billadeau DD.J Immunol. 2009 Jun 1;182(11):6933-42.

NCBI and Uniprot Product Information

• NCBI GI #: 4885153
• NCBI GeneID: 1399
• NCBI Accession #: NP_005198
• NCBI GenBank Nucleotide #: NM_005207
• UniProt Accession #: P46109; A8KA44; D3DX35
• Molecular Weight: 35.9 kDa (323aa), confirmed by MALDI-TOF
• NCBI Official Full Name: crk-like protein
• NCBI Official Synonym Full Names: CRK like proto-oncogene, adaptor protein
• NCBI Official Symbol: CRKL
• NCBI Protein Information: crk-like protein
• UniProt Protein Name: Crk-like protein
• Protein Family: Crk-like protein
• UniProt Gene Name: CRKL
• UniProt Entry Name: CRKL_HUMAN

NCBI Description

This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic.[provided by RefSeq, Jan 2009]

Uniprot Description

CRKL: an oncogenic adaptor protein with an SH2-SH3-SH3 domain structure. Plays a specific role in integrin-induced migration as a downstream mediator of Src. Activates the RAS and Jnk signaling pathways. Transforms fibroblasts in a RAS-dependent fashion. A substrate of BCR-ABL and plays a role in fibroblast transformation by BCR-ABL.

Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: cytosol; endosome

Molecular Function: protein binding; signal transducer activity; SH3/SH2 adaptor activity

Biological Process: anterior/posterior pattern formation; blood vessel development; organ morphogenesis; nerve growth factor receptor signaling pathway; activation of MAPKK activity; thymus development; heart development; Ras protein signal transduction; JNK cascade; parathyroid gland development