Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CRIPT is 0.03 ng/ml as a capture antibody.)

Mouse CRIPT Monoclonal Antibody | anti-CRIPT antibody

CRIPT (Cysteine-Rich PDZ-Binding Protein, HSPC139) (Biotin)

Gene Names
CRIPT; SSMDF; HSPC139
Applications
Western Blot
Purity
Purified
Synonyms
CRIPT; Monoclonal Antibody; CRIPT (Cysteine-Rich PDZ-Binding Protein; HSPC139) (Biotin); Cysteine-Rich PDZ-Binding Protein; HSPC139; anti-CRIPT antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D7
Specificity
Recognizes CRIPT.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CRIPT antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CRIPT (NP_054890.1, 1aa-101aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CRIPT is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CRIPT is 0.03 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of CRIPT expression in transfected 293T cell line by CRIPT monoclonal antibody (M03), clone 4D7.Lane 1: CRIPT transfected lysate (Predicted MW: 11.2 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CRIPT expression in transfected 293T cell line by CRIPT monoclonal antibody (M03), clone 4D7.Lane 1: CRIPT transfected lysate (Predicted MW: 11.2 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB)

(CRIPT monoclonal antibody (M03), clone 4D7. Western Blot analysis of CRIPT expression in HeLa.)

Western Blot (WB) (CRIPT monoclonal antibody (M03), clone 4D7. Western Blot analysis of CRIPT expression in HeLa.)
Related Product Information for anti-CRIPT antibody
Mouse monoclonal antibody raised against a partial recombinant CRIPT.
Product Categories/Family for anti-CRIPT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,216 Da
NCBI Official Full Name
cysteine-rich PDZ-binding protein
NCBI Official Synonym Full Names
cysteine-rich PDZ-binding protein
NCBI Official Symbol
CRIPT
NCBI Official Synonym Symbols
SSMDF; HSPC139
NCBI Protein Information
cysteine-rich PDZ-binding protein; cysteine-rich interactor of PDZ three; cysteine-rich interactor of PDZ3; postsynaptic protein CRIPT
UniProt Protein Name
Cysteine-rich PDZ-binding protein
UniProt Gene Name
CRIPT
UniProt Synonym Gene Names
Cysteine-rich interactor of PDZ3
UniProt Entry Name
CRIPT_HUMAN

NCBI Description

This gene encodes a protein that binds to the PDZ3 peptide recognition domain. The encoded protein may modulates protein interactions with the cytoskeleton. A mutation in this gene resulted in short stature with microcephaly and distinctive facies. [provided by RefSeq, Jun 2014]

Uniprot Description

CRIPT: Involved in the cytoskeletal anchoring of DLG4 in excitatory synapses. Belongs to the CRIPT family.

Chromosomal Location of Human Ortholog: 2p21

Cellular Component: cell soma; postsynaptic density; cytoplasm; dendrite; dendritic spine; nucleolus; dendritic shaft; cell junction; nucleus

Molecular Function: protein binding; microtubule binding; protein complex binding; PDZ domain binding

Biological Process: establishment of protein localization; cytoplasmic microtubule organization and biogenesis

Disease: Short Stature With Microcephaly And Distinctive Facies

Research Articles on CRIPT

Similar Products

Product Notes

The CRIPT cript (Catalog #AAA6174635) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CRIPT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRIPT cript for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRIPT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.