Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human CREM Monoclonal Antibody | anti-CREM antibody

CREM (cAMP-responsive Element Modulator, Inducible cAMP Early Repressor, ICER) (HRP)

Gene Names
CREM; ICER; CREM-2; hCREM-2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CREM; Monoclonal Antibody; CREM (cAMP-responsive Element Modulator; Inducible cAMP Early Repressor; ICER) (HRP); anti-CREM antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B5
Specificity
Recognizes human CREM.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
300
Applicable Applications for anti-CREM antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa201-300 from human CREM (NP_853549) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(CREM monoclonal antibody. Western Blot analysis of CREM expression in human liver.)

Western Blot (WB) (CREM monoclonal antibody. Western Blot analysis of CREM expression in human liver.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CREM on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CREM on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-CREM antibody
Transcriptional regulator that binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. Isoforms are either transcriptional activators or repressors. Plays a role in spermatogenesis and is involved in spermatid maturation.
Product Categories/Family for anti-CREM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cAMP-responsive element modulator isoform 1
NCBI Official Synonym Full Names
cAMP responsive element modulator
NCBI Official Symbol
CREM
NCBI Official Synonym Symbols
ICER; CREM-2; hCREM-2
NCBI Protein Information
cAMP-responsive element modulator
UniProt Protein Name
cAMP-responsive element modulator
UniProt Gene Name
CREM
UniProt Synonym Gene Names
ICER
UniProt Entry Name
CREM_HUMAN

NCBI Description

This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq, Jul 2008]

Uniprot Description

CREM: a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. An important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative splice isoforms allow this protein to exert spatial and temporal specificity to cAMP responsiveness. Twentyeight alternatively spliced isoforms of the human protein have been described, with some of them functioning as activators and some as repressors of transcription.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 10p11.21

Cellular Component: transcription factor complex; cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; cAMP response element binding protein binding; transcription factor activity

Biological Process: response to cAMP; regulation of transcription, DNA-dependent; transcription, DNA-dependent; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter; glycosphingolipid metabolic process; spermatogenesis; circadian regulation of gene expression; signal transduction; negative regulation of transcription, DNA-dependent; cell differentiation

Research Articles on CREM

Similar Products

Product Notes

The CREM crem (Catalog #AAA6151959) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CREM (cAMP-responsive Element Modulator, Inducible cAMP Early Repressor, ICER) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CREM can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CREM crem for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CREM, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.