Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CREB5 monoclonal antibody Western Blot analysis of CREB5 expression in Hela NE)

Mouse anti-Human, Mouse CREB5 Monoclonal Antibody | anti-CREB5 antibody

CREB5 (Cyclic AMP-responsive Element-binding Protein 5, CREB-5, cAMP-responsive Element-binding Protein 5, CRE-BPa, CREBPA) APC

Gene Names
CREB5; CREB-5; CREBPA; CRE-BPA
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CREB5; Monoclonal Antibody; CREB5 (Cyclic AMP-responsive Element-binding Protein 5; CREB-5; cAMP-responsive Element-binding Protein 5; CRE-BPa; CREBPA) APC; anti-CREB5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8A5
Specificity
Recognizes human CREB5. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
7743
Applicable Applications for anti-CREB5 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-99 from CREB5 (NP_001011666) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CREB5 monoclonal antibody Western Blot analysis of CREB5 expression in Hela NE)

Western Blot (WB) (CREB5 monoclonal antibody Western Blot analysis of CREB5 expression in Hela NE)

Western Blot (WB)

(CREB5 monoclonal antibody Western Blot analysis of CREB5 expression in Raw 264.7)

Western Blot (WB) (CREB5 monoclonal antibody Western Blot analysis of CREB5 expression in Raw 264.7)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CREB5 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CREB5 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CREB5 on HeLa cell. [antibody concentration 10ug/ml)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CREB5 on HeLa cell. [antibody concentration 10ug/ml)

Testing Data

(Detection limit for recombinant GST tagged CREB5 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CREB5 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-CREB5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens cAMP responsive element binding protein 5 (CREB5), transcript variant 4, mRNA
NCBI Official Synonym Full Names
cAMP responsive element binding protein 5
NCBI Official Symbol
CREB5
NCBI Official Synonym Symbols
CREB-5; CREBPA; CRE-BPA
NCBI Protein Information
cyclic AMP-responsive element-binding protein 5

NCBI Description

The product of this gene belongs to the CRE (cAMP response element)-binding protein family. Members of this family contain zinc-finger and bZIP DNA-binding domains. The encoded protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Research Articles on CREB5

Similar Products

Product Notes

The CREB5 (Catalog #AAA6136047) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CREB5 (Cyclic AMP-responsive Element-binding Protein 5, CREB-5, cAMP-responsive Element-binding Protein 5, CRE-BPa, CREBPA) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CREB5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CREB5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CREB5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.