Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Mouse anti-Human CPT1A Monoclonal Antibody | anti-CPT1A antibody

CPT1A (Carnitine O-palmitoyltransferase 1, Liver Isoform, CPT1-L, Carnitine O-palmitoyltransferase I, Liver Isoform, CPTI-L, CPT I, Carnitine Palmitoyltransferase 1A, CPT1) (FITC)

Gene Names
CPT1A; CPT1; CPT1-L; L-CPT1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CPT1A; Monoclonal Antibody; CPT1A (Carnitine O-palmitoyltransferase 1; Liver Isoform; CPT1-L; Carnitine O-palmitoyltransferase I; CPTI-L; CPT I; Carnitine Palmitoyltransferase 1A; CPT1) (FITC); anti-CPT1A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D3
Specificity
Recognizes human CPT1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CPT1A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa461-550 from human CPT1A (NP_001867.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFP
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Testing Data

(Detection limit for recombinant GST tagged CPT1A is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CPT1A is ~1ng/ml as a capture antibody.)
Related Product Information for anti-CPT1A antibody
The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.
Product Categories/Family for anti-CPT1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86,239 Da
NCBI Official Full Name
carnitine O-palmitoyltransferase 1, liver isoform isoform 1
NCBI Official Synonym Full Names
carnitine palmitoyltransferase 1A (liver)
NCBI Official Symbol
CPT1A
NCBI Official Synonym Symbols
CPT1; CPT1-L; L-CPT1
NCBI Protein Information
carnitine O-palmitoyltransferase 1, liver isoform; CPT I; CPTI-L; carnitine palmitoyltransferase I, liver; carnitine O-palmitoyltransferase I, liver isoform
UniProt Protein Name
Carnitine O-palmitoyltransferase 1, liver isoform
UniProt Gene Name
CPT1A
UniProt Synonym Gene Names
CPT1; CPT1-L; CPT I; CPTI-L
UniProt Entry Name
CPT1A_HUMAN

NCBI Description

The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CPT1A: Belongs to the carnitine/choline acetyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Transferase; EC 2.3.1.21; Membrane protein, integral; Membrane protein, multi-pass; Lipid Metabolism - fatty acid

Chromosomal Location of Human Ortholog: 11q13.2

Cellular Component: mitochondrial outer membrane; membrane; mitochondrion; mitochondrial inner membrane; integral to mitochondrial outer membrane

Molecular Function: identical protein binding; carnitine O-palmitoyltransferase activity

Biological Process: circadian rhythm; response to drug; eating behavior; glucose metabolic process; carnitine shuttle; long-chain fatty acid metabolic process; cellular lipid metabolic process; response to organic cyclic substance; positive regulation of fatty acid beta-oxidation; triacylglycerol metabolic process; fatty acid beta-oxidation; epithelial cell differentiation; carnitine metabolic process; regulation of insulin secretion; protein homooligomerization

Disease: Carnitine Palmitoyltransferase I Deficiency

Research Articles on CPT1A

Similar Products

Product Notes

The CPT1A cpt1a (Catalog #AAA6146642) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CPT1A (Carnitine O-palmitoyltransferase 1, Liver Isoform, CPT1-L, Carnitine O-palmitoyltransferase I, Liver Isoform, CPTI-L, CPT I, Carnitine Palmitoyltransferase 1A, CPT1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CPT1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CPT1A cpt1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CPT1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.