Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.33kD).)

Mouse anti-Human CORO1A Monoclonal Antibody | anti-CORO1A antibody

CORO1A (Coronin-1A, Coronin-like Protein A, Clipin-A, Coronin-like Protein p57, Tryptophan Aspartate-containing Coat Protein, TACO, CORO1, FLJ41407, MGC117380) APC

Gene Names
CORO1A; p57; IMD8; TACO; CLABP; HCORO1; CLIPINA
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CORO1A; Monoclonal Antibody; CORO1A (Coronin-1A; Coronin-like Protein A; Clipin-A; Coronin-like Protein p57; Tryptophan Aspartate-containing Coat Protein; TACO; CORO1; FLJ41407; MGC117380) APC; anti-CORO1A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G10
Specificity
Recognizes human CORO1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CORO1A antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa360-462 from CORO1A (NP_009005) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.33kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.33kD).)

Western Blot (WB)

(CORO1A monoclonal antibody Western Blot analysis of CORO1A expression in K-562)

Western Blot (WB) (CORO1A monoclonal antibody Western Blot analysis of CORO1A expression in K-562)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CORO1A on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CORO1A on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CORO1A is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CORO1A is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-CORO1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,026 Da
NCBI Official Full Name
coronin-1A
NCBI Official Synonym Full Names
coronin, actin binding protein, 1A
NCBI Official Symbol
CORO1A
NCBI Official Synonym Symbols
p57; IMD8; TACO; CLABP; HCORO1; CLIPINA
NCBI Protein Information
coronin-1A
UniProt Protein Name
Coronin-1A
Protein Family
UniProt Gene Name
CORO1A
UniProt Synonym Gene Names
CORO1; Clipin-A; TACO
UniProt Entry Name
COR1A_HUMAN

NCBI Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Alternative splicing results in multiple transcript variants. A related pseudogene has been defined on chromosome 16. [provided by RefSeq, Sep 2010]

Uniprot Description

coronin 1A: May be a crucial component of the cytoskeleton of highly motile cells, functioning both in the invagination of large pieces of plasma membrane, as well as in forming protrusions of the plasma membrane involved in cell locomotion. In mycobacteria- infected cells, its retention on the phagosomal membrane prevents fusion between phagosomes and lysosomes. Belongs to the WD repeat coronin family.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: cortical actin cytoskeleton; protein complex; early endosome; immunological synapse; actin filament; phagocytic vesicle; intercellular junction; phagocytic vesicle membrane; membrane; axon; lamellipodium; cytoplasm; plasma membrane; nucleus; phagocytic cup

Molecular Function: actin filament binding; protein C-terminus binding; protein binding; protein homodimerization activity; cytoskeletal protein binding; phosphoinositide 3-kinase binding

Biological Process: negative regulation of vesicle fusion; leukocyte chemotaxis; actin filament organization; regulation of release of sequestered calcium ion into cytosol; cell-substrate adhesion; phagocytosis; uropod organization and biogenesis; phagolysosome formation; regulation of cell shape; regulation of actin filament polymerization; positive chemotaxis; homeostasis of number of cells within a tissue; calcium ion transport; negative regulation of actin nucleation; innate immune response; positive regulation of T cell proliferation; T cell homeostasis; negative regulation of neuron apoptosis; cell motility; actin cytoskeleton organization and biogenesis; positive regulation of cell migration

Disease: Immunodeficiency 8

Research Articles on CORO1A

Similar Products

Product Notes

The CORO1A coro1a (Catalog #AAA6136016) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CORO1A (Coronin-1A, Coronin-like Protein A, Clipin-A, Coronin-like Protein p57, Tryptophan Aspartate-containing Coat Protein, TACO, CORO1, FLJ41407, MGC117380) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CORO1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CORO1A coro1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CORO1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.