Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD) using 125235.)

Mouse anti-Human CORIN Monoclonal Antibody | anti-CORIN antibody

CORIN (Atrial Natriuretic Peptide-converting Enzyme, Pro-ANP-converting Enzyme, Corin, Heart-specific Serine Proteinase ATC2, Transmembrane Protease, Serine 10, Atrial Natriuretic Peptide-converting Enzyme, N-terminal Propeptide, Atrial Natriuretic Peptid

Gene Names
CORIN; CRN; ATC2; Lrp4; PEE5; TMPRSS10
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CORIN; Monoclonal Antibody; CORIN (Atrial Natriuretic Peptide-converting Enzyme; Pro-ANP-converting Enzyme; Corin; Heart-specific Serine Proteinase ATC2; Transmembrane Protease; Serine 10; Atrial Natriuretic Peptide-converting Enzyme; N-terminal Propeptide; Atrial Natriuretic Peptid; anti-CORIN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5B6
Specificity
Recognizes human CORIN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
1042
Applicable Applications for anti-CORIN antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa616-715 from human CORIN with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD) using 125235.)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD) using 125235.)

Testing Data

(Detection limit for 125235 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for 125235 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-CORIN antibody
CORIN is a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. This protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase.
Product Categories/Family for anti-CORIN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
atrial natriuretic peptide-converting enzyme isoform 1
NCBI Official Synonym Full Names
corin, serine peptidase
NCBI Official Symbol
CORIN
NCBI Official Synonym Symbols
CRN; ATC2; Lrp4; PEE5; TMPRSS10
NCBI Protein Information
atrial natriuretic peptide-converting enzyme
UniProt Protein Name
Atrial natriuretic peptide-converting enzyme
UniProt Gene Name
CORIN
UniProt Synonym Gene Names
CRN; TMPRSS10
UniProt Entry Name
CORIN_HUMAN

NCBI Description

This gene encodes a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2013]

Uniprot Description

CORIN: Serine-type endopeptidase involved in atrial natriuretic peptide hormone (NPPA) processing. Converts through proteolytic cleavage the non-functional propeptide NPPA into the active hormone, thereby regulating blood pressure in heart and promoting natriuresis, diuresis and vasodilation. Proteolytic cleavage of pro-NPPA also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Also acts as a regulator of sodium reabsorption in kidney. May also process pro-NPPB the B-type natriuretic peptide. Defects in CORIN are the cause of pre-eclampsia/eclampsia 5 (PEE5); also known as gestational proteinuric hypertension. Preeclampsia is a pregnancy-associated disease with maternal symptoms but placental origin. Unlike most other human disorders, it impacts 2 individuals, the mother and her child, both of whom can be severely affected. Belongs to the peptidase S1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell surface; EC 3.4.21.-; Protease

Chromosomal Location of Human Ortholog: 4p12

Cellular Component: cell surface; integral to plasma membrane; integral to membrane; extracellular region; plasma membrane

Molecular Function: serine-type endopeptidase activity

Biological Process: regulation of blood pressure; peptide hormone processing; female pregnancy; proteolysis; regulation of systemic arterial blood pressure by atrial natriuretic peptide

Disease: Preeclampsia/eclampsia 5

Research Articles on CORIN

Similar Products

Product Notes

The CORIN corin (Catalog #AAA6232274) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CORIN (Atrial Natriuretic Peptide-converting Enzyme, Pro-ANP-converting Enzyme, Corin, Heart-specific Serine Proteinase ATC2, Transmembrane Protease, Serine 10, Atrial Natriuretic Peptide-converting Enzyme, N-terminal Propeptide, Atrial Natriuretic Peptid reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CORIN can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CORIN corin for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CORIN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.