Mouse anti-Human Collapsin Response Mediator Protein 3 Monoclonal Antibody | anti-CRMP3 antibody

Collapsin Response Mediator Protein 3 (CRMP3, DPYSL4, DRP-4, ULIP4, Dihydropyrimidinase-like 4, DRP-4, Dihydropyrimidinase-relate protein 3, Collapsin response mediator protein 3, CRMP-3, UNC33-like phosphoprotein 4, CRMP3, ULIP4) (HRP)

Cat. Num. AAA6151906

• Gene Names: DPYSL4; CRMP3; DRP-4; ULIP4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Collapsin Response Mediator Protein 3; Monoclonal Antibody; Collapsin Response Mediator Protein 3 (CRMP3; DPYSL4; DRP-4; ULIP4; Dihydropyrimidinase-like 4; Dihydropyrimidinase-relate protein 3; Collapsin response mediator protein 3; CRMP-3; UNC33-like phosphoprotein 4; CRMP3; ULIP4) (HRP); anti-CRMP3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1F5
• Specificity: Recognizes human DPYSL4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 2664

• Applicable Applications for anti-CRMP3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa461-559 from DPYSL4 (NP_006417) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIM
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of DPYSL4 expression in transfected 293T cell line by DPYSL4 monoclonal antibody Lane 1: DPYSL4 transfected lysate (Predicted MW: 61.9kD). Lane 2: Non-transfected lysate)

Immunoprecipitation (IP)

(Immunoprecipitation of DPYSL4 transfected lysate using DPYSL4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DPYSL4 monoclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged DPYSL4 is 1ng/ml as a capture antibody.)

Related Product Information for anti-CRMP3 antibody

DRP-4 belongs to the hydantoinase/dihydropyrimidase subfamily. It is required for signalling by class 3 semaphorins and remodelling of the cytoskeleton. It also plays a role in axon guidance, neuronal growth cone collapse and cell migration. It exists as homotetramer and a heterotetramer. Antibodies against post-translationally modified DPR-4 are present in sera from patients with paraneoplastic neurological diseases.

Product Categories/Family for anti-CRMP3 antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 1519243435
• NCBI GeneID: 10570
• NCBI Accession #: NM_006426.3
• NCBI GenBank Nucleotide #: NM_006426
• UniProt Accession #: O14531
• NCBI Official Full Name: Homo sapiens dihydropyrimidinase like 4 (DPYSL4), mRNA
• NCBI Official Synonym Full Names: dihydropyrimidinase like 4
• NCBI Official Symbol: DPYSL4
• NCBI Official Synonym Symbols: CRMP3; DRP-4; ULIP4
• NCBI Protein Information: dihydropyrimidinase-related protein 4
• UniProt Protein Name: Dihydropyrimidinase-related protein 4
• UniProt Gene Name: DPYSL4
• UniProt Synonym Gene Names: CRMP3; ULIP4; DRP-4; CRMP-3; ULIP-4
• UniProt Entry Name: DPYL4_HUMAN

Uniprot Description

CRMP-3: Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration. Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 10q26

Cellular Component: cytosol

Molecular Function: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides

Biological Process: axon guidance; nervous system development; pyrimidine base catabolic process