Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human CNOT3 Monoclonal Antibody | anti-CNOT3 antibody

CNOT3 (KIAA0691, LENG2, NOT3, CCR4-NOT Transcription Complex Subunit 3, CCR4-associated Factor 3, Leukocyte Receptor Cluster Member 2)

Gene Names
CNOT3; NOT3; LENG2; NOT3H
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CNOT3; Monoclonal Antibody; CNOT3 (KIAA0691; LENG2; NOT3; CCR4-NOT Transcription Complex Subunit 3; CCR4-associated Factor 3; Leukocyte Receptor Cluster Member 2); Anti -CNOT3 (KIAA0691; anti-CNOT3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B8
Specificity
Recognizes human CNOT3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT
Applicable Applications for anti-CNOT3 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa1-101 from human CNOT3 (NP_055331) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(CNOT3 monoclonal antibody Western Blot analysis of CNOT3 expression in HeLa NE..)

Western Blot (WB) (CNOT3 monoclonal antibody Western Blot analysis of CNOT3 expression in HeLa NE..)

Western Blot (WB)

(Western Blot analysis of CNOT3 expression in transfected 293T cell line by CNOT3 monoclonal antibody.|Lane 1: CNOT3 transfected lysate (82kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CNOT3 expression in transfected 293T cell line by CNOT3 monoclonal antibody.|Lane 1: CNOT3 transfected lysate (82kD).|Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CNOT3 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CNOT3 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CNOT3 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CNOT3 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-CNOT3 antibody
The CCR4-NOT complex functions as general transcription regulation complex.
Product Categories/Family for anti-CNOT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81,872 Da
NCBI Official Full Name
CCR4-NOT transcription complex subunit 3
NCBI Official Synonym Full Names
CCR4-NOT transcription complex, subunit 3
NCBI Official Symbol
CNOT3
NCBI Official Synonym Symbols
NOT3; LENG2; NOT3H
NCBI Protein Information
CCR4-NOT transcription complex subunit 3; CCR4-associated factor 3; leukocyte receptor cluster member 2; NOT3 (negative regulator of transcription 3, yeast) homolog
UniProt Protein Name
CCR4-NOT transcription complex subunit 3
UniProt Gene Name
CNOT3
UniProt Synonym Gene Names
KIAA0691; LENG2; NOT3
UniProt Entry Name
CNOT3_HUMAN

Uniprot Description

Function: Component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. Additional complex functions may be a consequence of its influence on mRNA expression. May be involved in metabolic regulation; may be involved in recruitment of the CCR4-NOT complex to deadenylation target mRNAs involved in energy metabolism. Involved in mitotic progression and regulation of the spindle assembly checkpoint by regulating the stability of MAD1L1 mRNA. Can repress transcription and may link the CCR4-NOT complex to transcriptional regulation; the repressive function may involve histone deacetylases. Involved in the maintenance of emryonic stem (ES) cell identity. Ref.6 Ref.13 Ref.14

Subunit structure: Component of the CCR4-NOT complex; distinct complexes seem to exist that differ in the participation of probably mutually exclusive catalytic subunits. In the complex interacts directly with CNOT2. Interacts with TIP120B and NANOS2. Ref.1 Ref.5 Ref.9 Ref.11

Subcellular location: Cytoplasm

Probable. Nucleus

Probable. Cytoplasm › P-body

By similarity. Note: NANOS2 promotes its localization to P-body

By similarity.

Tissue specificity: Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes. Ref.1

Developmental stage: Expressed in embryonic stem (ES) cells. Ref.14

Sequence similarities: Belongs to the CNOT2/3/5 family.

Sequence caution: The sequence BAA31666.2 differs from that shown. Reason: Erroneous initiation.

Research Articles on CNOT3

Similar Products

Product Notes

The CNOT3 cnot3 (Catalog #AAA648321) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CNOT3 (KIAA0691, LENG2, NOT3, CCR4-NOT Transcription Complex Subunit 3, CCR4-associated Factor 3, Leukocyte Receptor Cluster Member 2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CNOT3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the CNOT3 cnot3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADKRKLQGE IDRCLKKVSE GVEQFEDIWQ KLHNAANANQ KEKYEADLKK EIKKLQRLRD QIKTWVASNE IKDKRQLIDN RKLIETQMER FKVVERETKT. It is sometimes possible for the material contained within the vial of "CNOT3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.