<
Western Blot (WB)
(CMAS monoclonal antibody (M05), clone 2E1. Western Blot analysis of CMAS expression in PC-12.)
Mouse CMAS Monoclonal Antibody | anti-CMAS antibody
CMAS (Cytidine Monophosphate N-acetylneuraminic Acid Synthetase) (Biotin)
Gene Names
CMAS; CSS
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
CMAS; Monoclonal Antibody; CMAS (Cytidine Monophosphate N-acetylneuraminic Acid Synthetase) (Biotin); Cytidine Monophosphate N-acetylneuraminic Acid Synthetase; anti-CMAS antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
20
Specificity
Recognizes CMAS.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CMAS antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CMAS (NP_061156, 164aa-263aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(CMAS monoclonal antibody (M05), clone 2E1. Western Blot analysis of CMAS expression in PC-12.)
Western Blot (WB)
(CMAS monoclonal antibody (M05), clone 2E1. Western Blot analysis of CMAS expression in PC-12.)
Western Blot (WB)
(CMAS monoclonal antibody (M05), clone 2E1. Western Blot analysis of CMAS expression in Hela S3 NE.)
Western Blot (WB)
(CMAS monoclonal antibody (M05), clone 2E1. Western Blot analysis of CMAS expression in Hela S3 NE.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to CMAS on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to CMAS on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to CMAS on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to CMAS on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-CMAS antibody
The enzyme encoded by this gene catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus. [provided by RefSeq]
Product Categories/Family for anti-CMAS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,561 Da
NCBI Official Full Name
N-acylneuraminate cytidylyltransferase
NCBI Official Synonym Full Names
cytidine monophosphate N-acetylneuraminic acid synthetase
NCBI Official Symbol
CMAS
NCBI Official Synonym Symbols
CSS
NCBI Protein Information
N-acylneuraminate cytidylyltransferase; CMP-N-acetylneuraminic acid synthase; CMP-N-acetylneuraminic acid synthetase; CMP-Neu5Ac synthetase; CMP-NeuNAc synthase; CMP-NeuNAc synthetase; CMP-sialic acid synthetase; cytidine 5'-monophosphate N-acetylneuramin
UniProt Protein Name
N-acylneuraminate cytidylyltransferase
Protein Family
UniProt Gene Name
CMAS
UniProt Synonym Gene Names
CMP-NeuNAc synthase
UniProt Entry Name
NEUA_HUMAN
Similar Products
Product Notes
The CMAS cmas (Catalog #AAA6173840) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CMAS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CMAS cmas for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CMAS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
